KEGG   Escherichia coli K-12 MG1655: b1488Help
Entry
b1488             CDS       T00007                                 

Gene name
ddpX
Definition
(RefSeq) D-alanyl-D-alanine dipeptidase
  KO
K08641  zinc D-Ala-D-Ala dipeptidase [EC:3.4.13.22]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco01502  Vancomycin resistance
eco02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    b1488 (ddpX)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    b1488 (ddpX)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:eco01002]
    b1488 (ddpX)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eco01011]
    b1488 (ddpX)
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:eco01504]
    b1488 (ddpX)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.13  Dipeptidases
    3.4.13.22  D-Ala-D-Ala dipeptidase
     b1488 (ddpX)
Peptidases and inhibitors [BR:eco01002]
 Metallo peptidases
  Family M15: zinc D-Ala-D-Ala carboxypeptidase family
   b1488 (ddpX)
Peptidoglycan biosynthesis and degradation proteins [BR:eco01011]
 Peptidoglycan biosynthesis and degradation
  Carboxypeptidase
   b1488 (ddpX)
Antimicrobial resistance genes [BR:eco01504]
 Gene sets
  Vancomycin resistance modules
   Vancomycin resistance, D-Ala-D-Lac type [MD:M00651]
    b1488 (ddpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M15 VanY Peptidase_M15_4
Motif
Other DBs
NCBI-GeneID: 945532
NCBI-ProteinID: NP_416005
Pasteur: yddT
RegulonDB: ECK120003371
ECOCYC: G6782
ASAP: ABE-0004960
UniProt: P77790
Position
complement(1562495..1563076)
Genome map
AA seq 193 aa AA seqDB search
MSDTTELVDLAVIFPDLEIELKYACADNITGKAIYQQARCLLHKDAITALAKSISIAQLS
GLQLVIYDAYRPQQAQAMLWQACPDPQYVVDVTVGSNHSRGTAIDLTLRDEHGNILDMGA
GFDEMHERSHAYHPSVPPAAQRNRLLLNAIMTGGGFVGISSEWWHFELPQAASYPLLADQ
FSCFISPGTQHVS
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtcggataccaccgaactggttgatttagccgtaatcttccctgatctggagatcgaa
ttgaaatacgcctgcgctgataacatcacaggtaaagctatttatcagcaagcgcgttgt
ctgttacacaaggatgcgattaccgcgctggcgaaaagtatcagcatcgcccagctgtca
gggttacaactggtgatttacgatgcgtatcgcccacaacaagcacaggcgatgttgtgg
caagcctgcccagacccgcaatatgttgttgatgtgacggtcggttctaatcacagccgt
ggcacggcgatcgacctgacgcttcgtgatgagcacgggaacatcctcgatatgggcgca
gggttcgatgaaatgcacgagcgctcccatgcctatcacccttccgtcccgcccgccgct
cagcgcaatcggctgttgctgaatgcgataatgactggtggcggttttgtcggtatctcc
agcgaatggtggcacttcgaattaccccaggcagcgagttaccctctgctcgctgatcaa
ttctcttgttttatatcccctggcacacagcacgtcagttaa

DBGET integrated database retrieval system