KEGG   Escherichia coli K-12 MG1655: b1533Help
Entry
b1533             CDS       T00007                                 

Gene name
eamA
Definition
(RefSeq) cysteine/O-acetylserine exporter EamA
  KO
K15268  O-acetylserine/cysteine efflux transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b1533 (eamA)
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b1533 (eamA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA CRT-like TPT
Motif
Other DBs
NCBI-GeneID: 946081
NCBI-ProteinID: NP_416050
Pasteur: ydeD
RegulonDB: ECK120001585
ECOCYC: EG11639
ASAP: ABE-0005116
UniProt: P31125
Position
complement(1620238..1621137)
Genome map
AA seq 299 aa AA seqDB search
MSRKDGVLALLVVVVWGLNFVVIKVGLHNMPPLMLAGLRFMLVAFPAIFFVARPKVPLNL
LLGYGLTISFAQFAFLFCAINFGMPAGLASLVLQAQAFFTIMLGAFTFGERLHGKQLAGI
ALAIFGVLVLIEDSLNGQHVAMLGFMLTLAAAFSWACGNIFNKKIMSHSTRPAVMSLVIW
SALIPIIPFFVASLILDGSATMIHSLVTIDMTTILSLMYLAFVATIVGYGIWGTLLGRYE
TWRVAPLSLLVPVVGLASAALLLDERLTGLQFLGAVLIMTGLYINVFGLRWRKAVKVGS
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgaaaagatggggtgttggcgctactggtagtggtcgtatgggggctaaatttt
gtggtcatcaaagtggggcttcataacatgccaccgctgatgctggccggtttgcgcttt
atgctggtcgcttttccggctatcttttttgtcgcacgaccgaaagtaccactgaatttg
ctgctggggtatggattaaccatcagttttgcgcagtttgcttttcttttttgtgccatt
aacttcggtatgcctgctggactggcttcgctggtgttacaggcacaggcgttttttact
atcatgcttggcgcgtttactttcggggagcgactgcatggcaaacaattggcggggatc
gccttagcgatttttggcgtactggtgttaatcgaagatagtctgaacggtcagcatgtg
gcgatgctcggctttatgttgaccctggcggcagcatttagttgggcgtgtggcaacatc
ttcaataaaaagatcatgtcgcactcaacgcgtccggcggtgatgtcgctggtaatctgg
agcgctttaatcccaatcattcccttctttgttgcctcgctgattctcgatggttccgca
accatgattcacagtctggttactatcgatatgaccaccatcttgtctctgatgtatctg
gcgtttgtggcgacaattgttggttatgggatctgggggacgttactgggacgctatgaa
acctggcgggttgcaccgttatcgttactggtgcccgtagtaggactggcaagtgcggca
ctattgttggatgaacgcttaacgggtctgcaatttttaggtgcggtgctcattatgacc
gggctgtatatcaatgtatttggcttgcggtggcgtaaagcggtaaaggtgggaagttaa

DBGET integrated database retrieval system