KEGG   Escherichia coli K-12 MG1655: b1561Help
Entry
b1561             CDS       T00007                                 

Gene name
rem
Definition
(RefSeq) Qin prophage; protein Rem
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SH2
Motif
Other DBs
NCBI-GeneID: 946109
NCBI-ProteinID: NP_416079
Pasteur: rem
RegulonDB: ECK120001113
ECOCYC: EG11129
ASAP: ABE-0005215
UniProt: P07010
Position
complement(1644651..1644902)
Genome map
AA seq 83 aa AA seqDB search
MMNIEELRKIFCEDGLYAVCVENGNLVSHYRIMCLRKNGAALINFVDARVTDGFILREGE
FVTSLQALKEIGIKAGFSAFSGE
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacatcgaagaactgcgtaaaattttttgtgaagatggcctctatgctgtgtgc
gttgaaaatggaaatcttgttagtcattaccgcattatgtgtttgcgaaagaatggggct
gcgttaattaattttgtggatgctcgggtcacggacggatttatcttgcgcgaaggtgag
tttgtcacttcattacaggcattgaaagagatcggaataaaagctggcttttctgctttt
tcaggagaataa

DBGET integrated database retrieval system