KEGG   Escherichia coli K-12 MG1655: b1566Help
Entry
b1566             CDS       T00007                                 

Gene name
flxA
Definition
(RefSeq) Qin prophage; uncharacterized protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlxA HAUS6_N Allexi_40kDa Peptidase_A3 DUF896 WASH-7_mid Eno-Rase_FAD_bd Lectin_N DUF948
Motif
Other DBs
NCBI-GeneID: 947392
NCBI-ProteinID: NP_416084
Pasteur: flxA
RegulonDB: ECK120003422
ECOCYC: G6833
ASAP: ABE-0005234
UniProt: P77609
Position
1646405..1646737
Genome map
AA seq 110 aa AA seqDB search
MSVTIQGNTSTVISNNSAPEGTSEIAKITRQIQVLTEKLGKISSEEGMTTQQKKEMAALV
QKQIESLWAQLEQLLRQQAEKKNEDATVQPDKKEEKKDDTNTAGTIDIYV
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcacaattcagggaaatacctcaaccgttatttcaaacaactccgccccggaa
ggaacatcagaaatagccaaaatcacaagacaaattcaggtgctgactgaaaagcttggg
aaaatctcatcggaagaggggatgacgacacagcagaaaaaagaaatggctgcattggta
cagaagcaaattgaaagcctctgggctcaactggagcagttgttaaggcagcaggcagag
aaaaagaatgaagacgcgacagttcagcctgataaaaaagaagagaaaaaagacgataca
aataccgctggcaccattgatatttacgtctaa

DBGET integrated database retrieval system