KEGG   Escherichia coli K-12 MG1655: b1582Help
Entry
b1582             CDS       T00007                                 

Gene name
ynfA
Definition
(RefSeq) UPF0060 family inner membrane protein
  KO
K09771  small multidrug resistance family-3 protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b1582 (ynfA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0060
Motif
Other DBs
NCBI-GeneID: 946125
NCBI-ProteinID: NP_416099
Pasteur: ynfA
RegulonDB: ECK120003429
ECOCYC: G6840
ASAP: ABE-0005279
UniProt: P76169
Position
complement(1655347..1655673)
Genome map
AA seq 108 aa AA seqDB search
MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHPAASGRVY
AAYGGVYVCTALMWLRVVDGVKLTLYDWTGALIALCGMLIIVAGWGRT
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaacaacgttactattttttgctactgcgctgtgtgaaattattggatgcttt
ctgccctggttgtggttaaaacgaaacgccagtatctggctgttgcttccggcggggatt
tcactggcgctgtttgtctggttgttaacgttgcatccagcggcgagtgggcgtgtttac
gcggcttatggtggcgtttatgtctgcacggcgttgatgtggctgcgcgttgtggatggc
gtgaaactgactctttatgactggacgggtgcgttgattgcgctttgcggcatgttgatc
attgttgcgggctgggggcgcacgtag

DBGET integrated database retrieval system