KEGG   Escherichia coli K-12 MG1655: b1595
Entry
b1595             CDS       T00007                                 

Gene name
ynfL
Definition
(RefSeq) putative DNA-binding transcriptional regulator
Organism
eco  Escherichia coli K-12 MG1655
SSDB
Motif
Pfam: LysR_substrate HTH_1 HTH_24 MarR_2 PBP_like_2
Other DBs
NCBI-GeneID: 946136
NCBI-ProteinID: NP_416112
Pasteur: ynfL
RegulonDB: ECK120003442
ECOCYC: G6853
ASAP: ABE-0005326
UniProt: P77559
Position
complement(1668699..1669592)
AA seq 297 aa
MNIELRHLRYFVAVAEELHFGRAAARLNISQPPLSQQIQALEQQIGARLLARTNRSVLLT
AAGKQFLADSRQILSMVDDAAARAERLHQGEAGELRIGFTSSAPFIRAVSDTLSLFRRDY
PDVHLQTREMNTREQIAPLIEGTLDMGLLRNTALPESLEHAVIVHEPLMAMIPHDHPLAN
NPNVTLAELAKEPFVFFDPHVGTGLYDDILGLMRRYHLTPVITQEVGEAMTIIGLVSAGL
GVSILPASFKRVQLNEMRWVPIAEEDAVSEMWLVWPKHHEQSPAARNFRIHLLNALR
NT seq 894 nt   +upstreamnt  +downstreamnt
atgaatattgaacttcgtcatctgcgttactttgttgctgttgcggaagagctgcatttc
gggcgcgccgctgcccgcctgaatatttcgcaaccgccgctaagtcagcagattcaggcg
ctggagcaacaaattggtgcccgactgctggcacgaaccaatcgcagtgtattgctgacg
gcagcaggaaaacagtttcttgcagatagtcggcaaatcctgtctatggtggatgacgct
gccgctcgcgctgaaaggctgcatcagggtgaagcgggggagttgcgcattggttttact
tcgtcggctccttttattcgggcggtgtccgatacgttatcgctgtttcgccgtgattat
cctgatgtccatttacaaacccgcgaaatgaacactcgcgagcaaatcgctccgctcatt
gaaggaacgctggatatgggattgctgcgtaacacagcgttaccggagtcgcttgaacac
gcagtcatcgtccatgaaccgcttatggcgatgatcccgcacgatcatcccctggcaaat
aacccgaatgtaacgctggctgaactggcgaaagaaccctttgtcttttttgatccgcac
gtcgggacagggctgtatgacgatattctcgggctgatgcgacgttaccatttgacgccc
gtcatcactcaggaggtgggcgaggcaatgaccatcatcggtctggtttccgccggtctg
ggtgtttcaattttgcctgcgtcatttaaacgtgttcagctcaacgaaatgcgctgggtg
ccgattgctgaagaggatgcggtttctgaaatgtggttggtctggccgaaacatcatgaa
caaagtccggctgcgcgtaactttcgtattcatctgctgaatgctctcaggtga

DBGET integrated database retrieval system