KEGG   Escherichia coli K-12 MG1655: b1599
Entry
b1599             CDS       T00007                                 

Symbol
mdtI
Name
(RefSeq) multidrug/spermidine efflux pump membrane subunit MdtI
  KO
K11742  spermidine export protein MdtI
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b1599 (mdtI)
Transporters [BR:eco02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   b1599 (mdtI)
SSDB
Motif
Pfam: Multi_Drug_Res EamA UPF0060 TMEM234 Nuc_sug_transp
Other DBs
NCBI-GeneID: 947333
NCBI-ProteinID: NP_416116
Pasteur: ydgE
RegulonDB: ECK120003446
ECOCYC: G6857
ASAP: ABE-0005343
UniProt: P69210
Position
complement(1672820..1673149)
AA seq 109 aa
MAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSLAAVLAAFSALSQAVKGID
LSVAYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMIMVKLA
NT seq 330 nt   +upstreamnt  +downstreamnt
atggcgcagtttgaatgggttcacgccgcctggctggcattggcaatcgtgctggaaatc
gttgctaacgtctttttgaaattttctgacggctttcgtcgcaaaatatttggcttgctc
tccctggcggcggtgctggctgcctttagtgcgctttctcaagccgttaaagggatcgac
ttgtctgtcgcttatgcattgtggggcgggtttggtattgccgccacgttagccgcaggt
tggatcttgtttggtcaacggttaaatcgtaaaggctggattggcctggtcttgctgttg
gctggaatgatcatggtgaaacttgcctga

DBGET integrated database retrieval system