KEGG   Escherichia coli K-12 MG1655: b1601Help
Entry
b1601             CDS       T00007                                 

Gene name
tqsA
Definition
(RefSeq) autoinducer 2 exporter
  KO
K11744  AI-2 transport protein TqsA
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    b1601 (tqsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AI-2E_transport DUF2067
Motif
Other DBs
NCBI-GeneID: 946142
NCBI-ProteinID: NP_416118
Pasteur: ydgG
RegulonDB: ECK120003448
ECOCYC: G6859
ASAP: ABE-0005350
UniProt: P0AFS5 A0A387D194
Position
1673913..1674947
Genome map
AA seq 344 aa AA seqDB search
MAKPIITLNGLKIVIMLGMLVIILCGIRFAAEIIVPFILALFIAVILNPLVQHMVRWRVP
RVLAVSILMTIIVMAMVLLLAYLGSALNELTRTLPQYRNSIMTPLQALEPLLQRVGIDVS
VDQLAHYIDPNAAMTLLTNLLTQLSNAMSSIFLLLLTVLFMLLEVPQLPGKFQQMMARPV
EGMAAIQRAIDSVSHYLVLKTAISIITGLVAWAMLAALDVRFAFVWGLLAFALNYIPNIG
SVLAAIPPIAQVLVFNGFYEALLVLAGYLLINLVFGNILEPRIMGRGLGLSTLVVFLSLI
FWGWLLGPVGMLLSVPLTIIVKIALEQTAGGQSIAVLLSDLNKE
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagccgatcatcacgctcaatggcctaaaaatcgtcattatgttgggaatgctg
gtcattattctctgcggtatccgttttgccgccgagatcatcgtgccgtttattctcgca
ttatttattgctgttattcttaacccgctggtgcaacacatggtccgctggcgtgtgccg
cgtgtactggcggtgtcgattttgatgaccatcatcgtgatggcgatggtgttgctatta
gcttatctgggttccgcgctcaacgagttgacgcggacgttaccgcaatatcgcaactct
attatgacgccgctgcaagcgcttgaaccgttgttgcaacgcgtagggattgacgtctca
gttgaccagctggcgcattatattgatccgaacgcggcgatgacgttgctcaccaactta
ttgacgcagttatctaatgccatgtcatcaatatttttattgctgctgacggtgctgttt
atgctgctcgaagtgccacaattgcccggaaaatttcagcaaatgatggcgcgtccggtt
gaagggatggcggcgattcaacgtgcgattgacagtgtttctcattatctggtgctgaaa
acagccatcagcatcatcaccggcctggtcgcctgggcgatgctcgccgcactcgatgtt
cgcttcgcttttgtctggggattgctggcctttgcgcttaattacatcccgaatattggt
tcagtcctcgcggcaatcccccctatcgctcaggtactggtgtttaatggcttctacgaa
gcgttgctggtgctggcgggatatctgctgattaatctggtcttcggcaatattctggag
ccgcgtatcatggggcgtgggctggggctttccacattggtggtatttttgtcgttgatt
ttttggggatggttgttaggaccggtgggtatgctgctttccgtgccgttgacaattatt
gtcaaaattgcgcttgaacaaacagcgggaggtcaaagcatcgccgttctgttaagcgat
ctcaataaagagtga

DBGET integrated database retrieval system