KEGG   Escherichia coli K-12 MG1655: b1605
Entry
b1605             CDS       T00007                                 

Symbol
ydgI
Name
(RefSeq) putative arginine:ornithine antiporter
  KO
K03758  arginine:ornithine antiporter / lysine permease
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b1605 (ydgI)
Transporters [BR:eco02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   b1605 (ydgI)
SSDB
Motif
Pfam: AA_permease_2 AA_permease
Other DBs
NCBI-GeneID: 945159
NCBI-ProteinID: NP_416122
Pasteur: ydgI
RegulonDB: ECK120003450
ECOCYC: G6861
ASAP: ABE-0005362
UniProt: P0AAE5
Position
1679557..1680939
AA seq 460 aa
MEKKLGLSALTALVLSSMLGAGVFSLPQNMAAVASPAALLIGWGITGAGILLLAFAMLIL
TRIRPELDGGIFTYAREGFGELIGFCSAWGYWLCAVIANVSYLVIVFSALSFFTDTPELR
LFGDGNTWQSIVGASALLWIVHFLILRGVQTAASINLVATLAKLLPLGLFVVLAMMMFKL
DTFKLDFTGLALGVPVWEQVKNTMLITLWVFIGVEGAVVVSARARNKRDVGKATLLAVLS
ALGVYLLVTLLSLGVVARPELAEIRNPSMAGLMVEMMGPWGEIIIAAGLIVSVCGAYLSW
TIMAAEVPFLAATHKAFPRIFARQNAQAAPSASLWLTNICVQICLVLIWLTGSDYNTLLT
IASEMILVPYFLVGAFLLKIATRPLHKAVGVGACIYGLWLLYASGPMHLLLSVVLYAPGL
LVFLYARKTHTHDNVLNRQEMVLIGMLLIASVPATWMLVG
NT seq 1383 nt   +upstreamnt  +downstreamnt
atggaaaagaaactgggactgagcgcactcaccgcgctggtattaagctcaatgctgggc
gcgggtgttttcagtctgccgcaaaatatggcggcagttgccagcccggcagcactgctc
atcggctggggtattactggcgctggcattttattgctggcctttgccatgctgatcctc
acgcgcattcgtcccgaacttgacggcggtatctttacctatgcccgcgaagggtttggc
gagctaatcggcttttgttccgcatggggatactggctgtgcgcagtcatcgccaacgtc
tcctatctggtgatcgttttttccgcgttaagcttttttacggacacgccggaattgcgc
ctgtttggcgatggtaatacctggcaatcgatagtcggtgcatcggctttattgtggatt
gttcactttttgatcctgcgcggggtgcaaaccgctgccagcattaacctggtggcgaca
ctggcaaaattgttgccgctgggtctgtttgttgtgctggcgatgatgatgttcaaactg
gataccttcaagctcgacttcaccggacttgcacttggcgtacccgtttgggaacaggtg
aaaaacaccatgctgatcaccctgtgggttttcattggtgtggaaggtgccgtggttgtt
tctgcgcgtgcgcgtaataaacgtgatgttggcaaagcgacactgctggcggttctctcc
gctctgggcgtttacttgctggtaacgctgctttcgctgggtgtggtggcacgtcctgaa
ctggctgaaattcgtaacccgtcaatggccggtctgatggtggaaatgatgggaccatgg
ggcgaaatcatcatcgctgccggtttgatcgtttccgtttgcggcgcgtacttaagctgg
accatcatggcagcagaagtaccgttcctggccgccactcataaagcattcccgcgcatt
tttgcgcgccagaacgcacaagctgcgccatccgcctcactgtggttgaccaacatctgc
gtgcaaatttgtctggtactcatctggctgaccggttccgattacaacacgttgctgacc
atcgcctcagaaatgattctggtgccctatttcctggtcggcgcgttcttgctgaaaatc
gcaacccgtccactgcataaagcggtaggtgtcggtgcctgcatttatggcttatggtta
ttgtacgcctctggtccaatgcacttgctgttatccgttgttctgtatgcaccggggctg
ctggttttcctgtacgcgcgcaaaacgcatacccatgataatgtactgaaccgtcaggaa
atggtgctgattggcatgctgttaattgcctcagttccggcgacctggatgctggtggga
taa

DBGET integrated database retrieval system