KEGG   Escherichia coli K-12 MG1655: b1619Help
Entry
b1619             CDS       T00007                                 

Gene name
hdhA
Definition
(RefSeq) 7-alpha-hydroxysteroid dehydrogenase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    b1619 (hdhA)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     b1619 (hdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR 3HCDH_N THF_DHG_CYH_C MccV
Motif
Other DBs
NCBI-GeneID: 946151
NCBI-ProteinID: NP_416136
Pasteur: hdhA
RegulonDB: ECK120000418
ECOCYC: EG10425
ASAP: ABE-0005419
UniProt: P0AET8
Structure
PDB: 

Position
complement(1697273..1698040)
Genome map
AA seq 255 aa AA seqDB search
MFNSDNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGG
QAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPFDMPMADFRRAYELNVF
SFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEK
NIRVNGIAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVS
GQILTVSGGGVQELN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgtttaattctgacaacctgagactcgacggaaaatgcgccatcatcacaggtgcgggt
gcaggtattggtaaagaaatcgccattacattcgcgacagctggcgcatctgtggtggtc
agtgatattaacgccgacgcagctaaccatgttgtagacgaaattcaacaactgggtggt
caggcatttgcctgccgttgtgatattacttccgaacaggaactctctgcactggcagac
tttgctatcagtaagctgggtaaagttgatattctggttaacaacgccggtggcggtgga
cctaaaccgtttgatatgccaatggcggattttcgccgtgcttatgaactgaatgtgttt
tcttttttccatctgtcacaacttgttgcgccagaaatggaaaaaaatggcggtggcgtt
attctgaccatcacttctatggcggcagaaaataaaaatataaacatgacttcctatgca
tcatctaaagctgcggccagtcatctggtcagaaatatggcgtttgacctgggtgaaaaa
aatattcgggtaaatggcattgcgccgggggcaatattaaccgatgccctgaaatccgtt
attacaccagaaattgaacaaaaaatgttacagcacacgccgatcagacgtctgggccaa
ccgcaagatattgctaacgcagcgctgttcctttgctcgcctgctgcgagctgggtaagc
ggacaaattctcaccgtctccggtggtggggtacaggagctcaattaa

DBGET integrated database retrieval system