KEGG   Escherichia coli K-12 MG1655: b1620Help
Entry
b1620             CDS       T00007                                 

Gene name
malI
Definition
(RefSeq) transcriptional repressor of Mal regulon
  KO
K16136  LacI family transcriptional regulator, maltose regulon regulatory protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eco03000]
    b1620 (malI)
Transcription factors [BR:eco03000]
 Prokaryotic Type
  Helix-turn-helix
   LacI family
    b1620 (malI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_1 LacI Peripla_BP_4 Peripla_BP_3 HTH_3 ANF_receptor RPS31 DHDPS HTH_31
Motif
Other DBs
NCBI-GeneID: 947104
NCBI-ProteinID: NP_416137
Pasteur: malI
RegulonDB: ECK120000550
ECOCYC: EG10557
ASAP: ABE-0005421
UniProt: P18811
Position
complement(1698152..1699180)
Genome map
AA seq 342 aa AA seqDB search
MATAKKITIHDVALAAGVSVSTVSLVLSGKGRISTATGERVNAAIEELGFVRNRQASALR
GGQSGVIGLIVRDLSAPFYAELTAGLTEALEAQGRMVFLLHGGKDGEQLAQRFSLLLNQG
VDGVVIAGAAGSSDDLRRMAEEKAIPVIFASRASYLDDVDTVRPDNMQAAQLLTEHLIRN
GHQRIAWLGGQSSSLTRAERVGGYCATLLKFGLPFHSDWVLECTSSQKQAAEAITALLRH
NPTISAVVCYNETIAMGAWFGLLKAGRQSGESGVDRYFEQQVSLAAFTDATPTTLDDIPV
TWASTPARELGITLADRMMQKITHEETHSRNLIIPARLIAAK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgccaaaaaaataaccattcatgatgttgcgctggctgcgggcgtgtcggta
agtaccgtttcgctggtgcttagtggcaaagggcgaatctctaccgccacaggagaacgc
gttaacgccgccattgaagagctgggatttgtgcgcaatcgccaggcgtcggcgctgcgc
ggcgggcaaagcggcgtcattggtttgatcgtccgtgatttatctgcgccgttttacgcc
gaattgacggccggattgacggaagctctggaagcgcagggacggatggtttttttgctt
cacggcggtaaagacggtgagcagctggcacagcggttttcactgttactgaatcagggt
gtcgatggtgtggtaattgccggagctgcaggaagtagcgatgacctgcgacggatggca
gaagaaaaagctatcccggtgattttcgcttcccgtgccagttatcttgatgatgttgat
acggttcgcccggacaacatgcaggctgcacagttgttgacggagcatctcattcgcaat
gggcatcagcggatcgcctggctgggagggcaaagttcctcattaacccgtgcagaacgg
gttgggggctattgtgcaactctactaaaatttggcctgccgtttcatagcgattgggtg
ttggagtgcacttccagccagaagcaagccgcggaagctatcacggcgcttttacgtcat
aacccgaccatcagtgccgtggtttgctataacgaaactattgcgatgggggcatggttt
ggtttgctcaaagcagggcggcaaagcggggaaagcggagtcgatcgttactttgagcaa
caggtttcgctggcggcatttaccgatgcgacaccaaccacacttgatgatatacctgtt
acctgggccagcacgccagcgcgggaacttggtatcacacttgcggatcgcatgatgcaa
aaaatcacccatgaagagacgcattcacgcaatcttattattcccgcccggctcattgca
gcgaaataa

DBGET integrated database retrieval system