KEGG   Escherichia coli K-12 MG1655: b1623Help
Entry
b1623             CDS       T00007                                 

Gene name
add
Definition
(RefSeq) adenosine deaminase
  KO
K01488  adenosine deaminase [EC:3.5.4.4]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00230  Purine metabolism
eco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    b1623 (add)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.4  adenosine deaminase
     b1623 (add)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: A_deaminase
Motif
Other DBs
NCBI-GeneID: 945851
NCBI-ProteinID: NP_416140
Pasteur: add
RegulonDB: ECK120000027
ECOCYC: EG10030
ASAP: ABE-0005435
UniProt: P22333 A0A387CVB8
Position
1702233..1703234
Genome map
AA seq 333 aa AA seqDB search
MIDTTLPLTDIHRHLDGNIRPQTILELGRQYNISLPAQSLETLIPHVQVIANEPDLVSFL
TKLDWGVKVLASLDACRRVAFENIEDAARHGLHYVELRFSPGYMAMAHQLPVAGVVEAVI
DGVREGCRTFGVQAKLIGIMSRTFGEAACQQELEAFLAHRDQITALDLAGDELGFPGSLF
LSHFNRARDAGWHITVHAGEAAGPESIWQAIRELGAERIGHGVKAIEDRALMDFLAEQQI
GIESCLTSNIQTSTVAELAAHPLKTFLEHGIRASINTDDPGVQGVDIIHEYTVAAPAAGL
SREQIRQAQINGLEMAFLSAEEKRALREKVAAK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgattgataccaccctgccattaactgatatccatcgccaccttgatggcaacattcgt
ccccagaccattcttgaacttggccgccagtataatatctcgcttcctgcacaatccctg
gaaacactgattccccacgttcaggtcattgccaacgaacccgatctggtgagctttctg
accaaacttgactggggcgttaaagttctcgcctctcttgatgcctgtcgccgcgtggca
tttgaaaacattgaagatgcagcccgtcacggcctgcactatgtcgagctgcgtttttca
ccaggctacatggcaatggcacatcagctgcctgtagcgggtgttgtcgaagcggtgatc
gatggcgtacgtgaaggttgccgcacctttggtgtgcaggcgaagcttatcggcattatg
agccggaccttcggcgaagccgcctgtcagcaagagctggaggcctttttagcccaccgt
gaccagattaccgcacttgatttagccggtgatgaacttggtttcccgggaagtctgttc
ctttctcacttcaaccgcgcgcgtgatgcgggctggcatattaccgtccatgcaggcgaa
gctgccgggccggaaagcatctggcaggcgattcgtgaactgggtgcggagcgtattgga
catggcgtaaaagccattgaagatcgggcgctgatggattttctcgccgagcaacaaatt
ggtattgaatcctgtctgacctccaatattcagaccagcaccgtagcagagctggctgca
catccgctgaaaacgttccttgagcatggcattcgtgccagcattaacactgacgatccc
ggcgtacagggagtggatatcattcacgaatataccgttgccgcgccagctgctgggtta
tcccgcgagcaaatccgccaggcacagattaatggtctggaaatggctttcctcagcgct
gaggaaaaacgcgcactgcgagaaaaagtcgccgcgaagtaa

DBGET integrated database retrieval system