KEGG   Escherichia coli K-12 MG1655: b1637Help
Entry
b1637             CDS       T00007                                 

Gene name
tyrS
Definition
(RefSeq) tyrosine--tRNA ligase
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:eco00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    b1637 (tyrS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:eco01007]
    b1637 (tyrS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:eco03016]
    b1637 (tyrS)
   03029 Mitochondrial biogenesis [BR:eco03029]
    b1637 (tyrS)
Enzymes [BR:eco01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     b1637 (tyrS)
Amino acid related enzymes [BR:eco01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   b1637 (tyrS)
Transfer RNA biogenesis [BR:eco03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    b1637 (tyrS)
 Prokaryotic type
    b1637 (tyrS)
Mitochondrial biogenesis [BR:eco03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    b1637 (tyrS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1b S4
Motif
Other DBs
NCBI-GeneID: 948855
NCBI-ProteinID: NP_416154
Pasteur: tyrS
RegulonDB: ECK120001032
ECOCYC: EG11043
ASAP: ABE-0005477
UniProt: P0AGJ9
Structure
PDB: 

Position
complement(1715948..1717222)
Genome map
AA seq 424 aa AA seqDB search
MASSNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSLHLGHLVPLLCLKR
FQQAGHKPVALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCGENS
AIAANNYDWFGNMNVLTFLRDIGKHFSVNQMINKEAVKQRLNREDQGISFTEFSYNLLQG
YDFACLNKQYGVVLQIGGSDQWGNITSGIDLTRRLHQNQVFGLTVPLITKADGTKFGKTE
GGAVWLDPKKTSPYKFYQFWINTADADVYRFLKFFTFMSIEEINALEEEDKNSGKAPRAQ
YVLAEQVTRLVHGEEGLQAAKRITECLFSGSLSALSEADFEQLAQDGVPMVEMEKGADLM
QALVDSELQPSRGQARKTIASNAITINGEKQSDPEYFFKEEDRLFGRFTLLRRGKKNYCL
ICWK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcagtaacttgattaaacaattgcaagagcgggggctggtagcccaggtgacg
gacgaggaagcgttagcagagcgactggcgcaaggcccgatcgcgctctattgcggcttc
gatcctaccgctgacagcttgcatttggggcatcttgttccattgttatgcctgaaacgc
ttccagcaggcgggccacaagccggttgcgctggtaggcggcgcgacgggtctgattggc
gacccgagcttcaaagctgccgagcgtaagctgaacaccgaagaaactgttcaggagtgg
gtggacaaaatccgtaagcaggttgccccgttcctcgatttcgactgtggagaaaactct
gctatcgcggcgaacaactatgactggttcggcaatatgaatgtgctgaccttcctgcgc
gatattggcaaacacttctccgttaaccagatgatcaacaaagaagcggttaagcagcgt
ctcaaccgtgaagatcaggggatttcgttcactgagttttcctacaacctgttgcagggt
tatgacttcgcctgtctgaacaaacagtacggtgtggtgctgcaaattggtggttctgac
cagtggggtaacatcacttctggtatcgacctgacccgtcgtctgcatcagaatcaggtg
tttggcctgaccgttccgctgatcactaaagcagatggcaccaaatttggtaaaactgaa
ggcggcgcagtctggttggatccgaagaaaaccagcccgtacaaattctaccagttctgg
atcaacactgcggatgccgacgtttaccgcttcctgaagttcttcacctttatgagcatt
gaagagatcaacgccctggaagaagaagataaaaacagcggtaaagcaccgcgcgcccag
tatgtactggcggagcaggtgactcgtctggttcacggtgaagaaggtttacaggcggca
aaacgtattaccgaatgcctgttcagcggttctttgagtgcgctgagtgaagcggacttc
gaacagctggcgcaggacggcgtaccgatggttgagatggaaaagggcgcagacctgatg
caggcactggtcgattctgaactgcaaccttcccgtggtcaggcacgtaaaactatcgcc
tccaatgccatcaccattaacggtgaaaaacagtccgatcctgaatacttctttaaagaa
gaagatcgtctgtttggtcgttttaccttactgcgtcgcggtaaaaagaattactgtctg
atttgctggaaataa

DBGET integrated database retrieval system