KEGG   Escherichia coli K-12 MG1655: b1647Help
Entry
b1647             CDS       T00007                                 

Gene name
ydhF
Definition
(RefSeq) putative oxidoreductase
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldo_ket_red Mlf1IP
Motif
Other DBs
NCBI-GeneID: 946960
NCBI-ProteinID: YP_025305
Pasteur: ydhF
RegulonDB: ECK120003476
ECOCYC: G6887
ASAP: ABE-0005508
UniProt: P76187
Structure
PDB: 

Position
complement(1724736..1725632)
Genome map
AA seq 298 aa AA seqDB search
MVQRITIAPQGPEFSRFVMGYWRLMDWNMSARQLVSFIEEHLDLGVTTVDHADIYGGYQC
EAAFGEALKLAPHLRERMEIVSKCGIATTAREENVIGHYITDRDHIIKSAEQSLINLATD
HLDLLLIHRPDPLMDADEVADAFKHLHQSGKVRHFGVSNFTPAQFALLQSRLPFTLATNQ
VEISPVHQPLLLDGTLDQLQQLRVRPMAWSCLGGGRLFNDDYFQPLRDELAVVAEELNAG
SIEQVVYAWVLRLPSQPLPIIGSGKIERVRAAVEAETLKMTRQQWFRIRKAALGYDVP
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggttcagcgtattactattgcgccgcaaggcccggagttttcccgttttgtgatgggc
tactggcgattgatggactggaatatgtccgcccgccagctggtcagttttattgaagag
catctggatctcggcgtgaccaccgtggaccatgctgatatttatggtggctatcagtgc
gaagcggcgtttggcgaggcactgaaactggcacctcacctgcgtgaacggatggaaatc
gtcagtaaatgcggtatcgcgacgaccgcgcgtgaagaaaacgtcattggtcattacatc
actgaccgcgatcacatcattaagagcgccgaacagtcgctaattaatctcgcgaccgat
catctggatttgctgttaatccaccgaccagacccgttaatggatgccgatgaagtggcg
gacgcgttcaaacatctgcatcagagcggcaaagtgcgtcattttggcgtatcgaacttt
acgcctgcgcaatttgccctgttgcaatcacgtctgccgtttacccttgccactaatcag
gtggaaatatccccggtgcatcagccgttactgctggatggcacgctcgaccaactacaa
caactgcgtgttcgtccgatggcgtggtcctgccttggtggtggtcgtctgtttaatgat
gattatttccagccgctgcgtgatgaactggctgtggtggcagaggagttaaacgcgggc
tcgattgaacaggtggtttacgcctgggtattacgtttaccatcgcagccgctgccaatt
atcggttcaggtaaaattgagcgcgtacgggcagctgtcgaagcagaaacactgaaaatg
acccgtcaacaatggtttcgtatccgtaaagcggcactggggtacgacgtaccgtaa

DBGET integrated database retrieval system