KEGG   Escherichia coli K-12 MG1655: b1695
Entry
b1695             CDS       T00007                                 

Gene name
ydiO
Definition
(RefSeq) putative acyl-CoA dehydrogenase
Organism
eco  Escherichia coli K-12 MG1655
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_2 Acyl-CoA_dh_N YopD
Other DBs
NCBI-GeneID: 945626
NCBI-ProteinID: NP_416210
Pasteur: ydiO
RegulonDB: ECK120003506
ECOCYC: G6918
ASAP: ABE-0005658
UniProt: P0A9U8
Position
1777196..1778347
AA seq 383 aa
MDFSLTEEQELLLASIRELITTNFPEEYFRTCDQNGTYPREFMRALADNGISMLGVPEEF
GGIPADYVTQMLALMEVSKCGAPAFLITNGQCIHSMRRFGSAEQLRKTAESTLETGDPAY
ALALTEPGAGSDNNSATTTYTRKNGKVYINGQKTFITGAKEYPYMLVLARDPQPKDPKKA
FTLWWVDSSKPGIKINPLHKIGWHMLSTCEVYLDNVEVEESDMVGEEGMGFLNVMYNFEM
ERLINAARSTGFAECAFEDAARYANQRIAFGKPIGHNQMIQEKLALMAIKIDNMRNMVLK
VAWQADQHQSLRTSAALAKLYCARTAMEVIDDAIQIMGGLGYTDEARVSRFWRDVRCERI
GGGTDEIMIYVAGRQILKDYQNK
NT seq 1152 nt   +upstreamnt  +downstreamnt
atggatttttctttaactgaagaacaagaactgctgctggccagtattcgcgaactgatt
acgactaactttccggaagagtatttccgcacctgcgatcaaaacgggacatatccgcgt
gagtttatgcgggcgctggcggataacggtatttccatgcttggcgtgccggaagaattt
ggtggtatccctgcggattacgtcacccaaatgctggcgctgatggaagtgtcaaaatgc
ggtgctccggcatttttaattaccaacggtcaatgtattcacagtatgcgccgtttcggt
tctgcagagcagctacgtaaaacggcagagagcaccctggaaacgggtgatcccgcctat
gccctggcgttgacggaaccaggtgctggctcagataacaacagtgccactaccacttac
acgcgtaaaaacggcaaggtctacatcaacggacaaaaaacctttattaccggtgcgaaa
gagtacccgtatatgctggtgctggcgcgcgatccgcaaccgaaagatcccaaaaaagcc
ttcaccctgtggtgggtcgactccagtaagcccggcattaagattaacccgctgcataaa
atcggctggcatatgctcagcacctgcgaagtctatctcgacaacgtggaggttgaagag
agcgacatggtgggcgaagaaggaatgggtttcctcaatgtgatgtacaactttgagatg
gagcgcctgatcaacgccgcgcgcagcaccggctttgccgaatgcgcctttgaagatgcc
gcccgctatgccaaccaacgtatcgcttttggtaagcccattggtcataaccagatgatc
caggaaaaactggcgctgatggcgattaagatcgacaacatgcgcaacatggtgctgaaa
gtggcatggcaagccgatcagcatcagtcactgcgcaccagcgcggcgctggcaaaactg
tactgtgcacgtaccgcaatggaagtcattgatgatgcgattcaaatcatgggcggtctg
ggctataccgatgaggcgcgcgtctcccgcttctggcgtgatgtccgttgtgaacgtatc
ggcggcggtacagacgaaattatgatttacgtagcaggtcggcagatcctgaaagactat
cagaacaaataa

DBGET integrated database retrieval system