KEGG   Escherichia coli K-12 MG1655: b1708Help
Entry
b1708             CDS       T00007                                 

Gene name
nlpC
Definition
(RefSeq) putative C40 clan peptidase lipoprotein
  KO
K13695  probable lipoprotein NlpC
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:eco01002]
    b1708 (nlpC)
Peptidases [BR:eco01002]
 Cysteine Peptidases
  Family C40
   b1708 (nlpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NLPC_P60 DUF1175 CHAP LPAM_1
Motif
Other DBs
NCBI-GeneID: 946220
NCBI-ProteinID: NP_416223
Pasteur: nlpC
RegulonDB: ECK120001117
ECOCYC: EG11133
ASAP: ABE-0005704
UniProt: P23898
Position
complement(1792267..1792731)
Genome map
AA seq 154 aa AA seqDB search
MRFCLILITALLLAGCSHHKAPPPNARLSDSITVIAGLNDQLQSWHGTPYRYGGMTRRGV
DCSGFVVVTMRDRFDLQLPRETKQQASIGTQIDKDELLPGDLVFFKTGSGQNGLHVGIYD
TNNQFIHASTSKGVMRSSLDNVYWQKNFWQARRI
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttctgccttattttgatcacagcactgcttctggccgggtgtagccaccataaa
gcaccgccgccaaatgccagactttctgattcgattaccgttattgccggtttgaacgac
cagctacaaagctggcatggcacgccgtatcgttatggtggcatgacgcggcgcggtgtg
gactgttcgggatttgtggttgtgacgatgcgcgatcgtttcgatttgcagctgccccgt
gaaaccaaacaacaagcctctattggcacgcaaattgataaagacgagttgctgccaggt
gacctggtctttttcaaaacggggtccggacaaaatggtttgcatgtaggtatttacgat
accaacaaccaatttatccacgcctctaccagcaagggagtgatgcgttcctcacttgat
aatgtctattggcagaaaaatttctggcaggcgagacgaatctag

DBGET integrated database retrieval system