KEGG   Escherichia coli K-12 MG1655: b1756Help
Entry
b1756             CDS       T00007                                 

Gene name
ynjD
Definition
(RefSeq) putative ABC transporter ATPase
  KO
K05779  putative thiamine transport system ATP-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Module
eco_M00192  Putative thiamine transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b1756 (ynjD)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putative thiamine transporter [MD:M00192] [OT]
    b1756 (ynjD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_25 AAA_29 AAA_16 RsgA_GTPase SbcCD_C AAA_22 RNA_helicase NACHT AAA_33 AAA_23 Rad17 NB-ARC
Motif
Other DBs
NCBI-GeneID: 944965
NCBI-ProteinID: NP_416270
Pasteur: ynjD
RegulonDB: ECK120003539
ECOCYC: G6951
ASAP: ABE-0005845
UniProt: P76909
Position
1838747..1839400
Genome map
AA seq 217 aa AA seqDB search
MLCVKNVSLRLPESRLLTNVNFTVDKGDIVTLMGPSGCGKSTLFSWMIGALAEQFSCTGE
LWLNEQRIDILPTAQRQIGILFQDALLFDQFSVGQNLLLALPATLKGNARRNAVNDALER
SGLEGAFHQDPATLSGGQRARVALLRALLAQPKALLLDEPFSRLDVALRDNFRQWVFSEV
RALAIPVVQVTHDLQDVPADSSVLDMAQWSENYNKLR
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgctctgcgtgaaaaatgtttcgctacgtttaccagaaagccgcttgctgacaaacgtt
aactttacggtggataaaggtgacattgtcacgttaatggggccgtctggctgtggaaaa
tccactctgttttcatggatgattggtgcactggccgaacagttttcttgtacaggtgag
ctatggctcaatgagcaacggattgacatcctacccaccgcacagcgtcagattggcatt
ctttttcaggatgcactgttatttgaccagttcagtgtcgggcaaaatttactgctggcg
ctaccggcgacacttaaagggaatgcccgacgtaatgccgtgaatgatgcacttgagcgt
tcaggccttgagggagctttccatcaggatcctgccactttgtctggcggtcagcgagcg
cgcgttgctctactacgcgcccttctcgcccaaccaaaagcgttactcctggatgagcca
ttcagccgtcttgatgtggctctgcgcgataattttcgccagtgggtgttcagcgaagtt
cgcgccctggcgatccccgtcgttcaggtaacgcacgatctccaggatgttcctgctgat
agttctgttctggatatggcgcagtggtcagaaaattacaacaaactgcgataa

DBGET integrated database retrieval system