KEGG   Escherichia coli K-12 MG1655: b1763Help
Entry
b1763             CDS       T00007                                 

Gene name
topB
Definition
(RefSeq) DNA topoisomerase III
  KO
K03169  DNA topoisomerase III [EC:5.6.2.1]
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:eco03032]
    b1763 (topB)
Enzymes [BR:eco01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.1  DNA topoisomerase
     b1763 (topB)
DNA replication proteins [BR:eco03032]
 Prokaryotic Type
  DNA Topoisomerases
   b1763 (topB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Topoisom_bac Toprim FYRC
Motif
Other DBs
NCBI-GeneID: 946141
NCBI-ProteinID: NP_416277
Pasteur: topB
RegulonDB: ECK120001003
ECOCYC: EG11014
ASAP: ABE-0005869
UniProt: P14294 A0A387CXD2
Structure
PDB: 

Position
complement(1844999..1846960)
Genome map
AA seq 653 aa AA seqDB search
MRLFIAEKPSLARAIADVLPKPHRKGDGFIECGNGQVVTWCIGHLLEQAQPDAYDSRYAR
WNLADLPIVPEKWQLQPRPSVTKQLNVIKRFLHEASEIVHAGDPDREGQLLVDEVLDYLQ
LAPEKRQQVQRCLINDLNPQAVERAIDRLRSNSEFVPLCVSALARARADWLYGINMTRAY
TILGRNAGYQGVLSVGRVQTPVLGLVVRRDEEIENFVAKDFFEVKAHIVTPADERFTAIW
QPSEACEPYQDEEGRLLHRPLAEHVVNRISGQPAIVTSYNDKRESESAPLPFSLSALQIE
AAKRFGLSAQNVLDICQKLYETHKLITYPRSDCRYLPEEHFAGRHAVMNAISVHAPDLLP
QPVVDPDIRNRCWDDKKVDAHHAIIPTARSSAINLTENEAKVYNLIARQYLMQFCPDAVF
RKCVIELDIAKGKFVAKARFLAEAGWRTLLGSKERDEENDGTPLPVVAKGDELLCEKGEV
VERQTQPPRHFTDATLLSAMTGIARFVQDKDLKKILRATDGLGTEATRAGIIELLFKRGF
LTKKGRYIHSTDAGKALFHSLPEMATRPDMTAHWESVLTQISEKQCRYQDFMQPLVGTLY
QLIDQAKRTPVRQFRGIVAPGSGGSADKKKAAPRKRSAKKSPPADEVGSGAIA
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgcggttgtttattgccgaaaaaccgagtctggcgcgcgccattgctgatgtcctgccc
aaaccgcaccggaaaggcgatggctttatcgagtgcggtaatggtcaggtggtgacctgg
tgtatcggtcacctgcttgagcaggcgcagccagacgcctacgacagccgctatgcgcgc
tggaatcttgcggatttgccgattgtcccggaaaagtggcaattacagccccgaccctcc
gtgaccaaacaacttaacgtcatcaaacggttcctgcatgaagccagcgaaatcgttcac
gccggggacccggatcgtgaagggcaattgctggtggatgaagtgctggactatctgcaa
ctggcaccggaaaagcgccagcaggtacagcgttgcttgataaacgacctgaacccgcag
gcggttgagcgggcgatcgaccgtcttcgttccaacagtgagtttgtaccgctgtgcgtt
tctgcgctggcgcgagcgcgtgccgactggctgtacggcatcaatatgacccgtgcgtat
accattctcggtcgcaatgccggttatcagggcgtactttccgtgggacgcgtgcagacg
cccgtgcttgggctggtggtgcgccgcgatgaagagattgaaaacttcgtggcgaaagac
ttctttgaagtcaaagcacatatcgtgacacctgccgatgagcggtttaccgctatctgg
caaccgagcgaagcgtgtgaaccgtaccaggatgaagaagggcgcttgttacatcgtcca
ctggcggagcatgtggttaaccgcattagtggtcaaccggctattgtcaccagctataac
gataaacgggaatcagaatccgcgccgctgcctttttcgctttcagcgttgcagattgaa
gcggcaaaacgttttggtctgagtgcgcagaacgtgcttgatatctgccagaaactgtac
gaaacgcacaagctaatcacttatccgcgttctgattgtcgctatttgccagaagaacat
tttgccggacgccacgcggtgatgaatgccatcagtgttcatgcaccggatctgttgccg
cagccagtggtagatccagatatacgcaaccgctgttgggatgacaaaaaggtcgatgcg
caccacgccatcattccgaccgcacggagttctgcgatcaacctgacggagaacgaagcg
aaggtctataacctgattgcccgtcagtatctgatgcaattctgcccggatgcggtgttc
cgcaagtgtgttatcgaactggacattgccaaaggcaaatttgtcgctaaagcgcgtttt
cttgctgaagcaggctggcgcacgctgttaggcagcaaagagcgcgatgaagaaaacgac
ggcacgccactgcctgtggtggcgaaaggcgatgagttgctgtgtgaaaaaggtgaagtg
gtagagcggcaaacccagccgccgcgccattttaccgatgcaacactgctttcggcgatg
accgggatcgcgcgctttgtgcaggataaagatctgaaaaagatcctccgtgcgaccgat
ggtctggggacagaggcaacgcgtgccgggattattgaactgttgttcaagcgtggtttc
ctgaccaaaaaagggcgctatatccactccaccgacgccggaaaagcgctattccattcg
ctgccggagatggcgacgcgaccggacatgaccgcgcactgggaatcggtgctgacgcaa
atcagcgaaaagcagtgtcgctatcaggactttatgcagccgctggtggggacgctatat
cagcttattgatcaagccaaacgtacgccggtgcggcagtttcgcggcattgtggctccg
ggcagtggtggcagtgctgataagaaaaaggctgcaccgcgtaaacgtagtgcgaaaaaa
agtccgccagcagatgaagtcggaagcggggcgatagcgtaa

DBGET integrated database retrieval system