KEGG   Escherichia coli K-12 MG1655: b1775
Entry
b1775             CDS       T00007                                 

Gene name
ydjK
Definition
(RefSeq) putative transporter YdjK
  KO
K08369  MFS transporter, putative metabolite:H+ symporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b1775 (ydjK)
Transporters [BR:eco02000]
 Major facilitator superfamily (MFS)
  Unknown transporters
   Others
    b1775 (ydjK)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 946293
NCBI-ProteinID: NP_416289
Pasteur: ydjK
RegulonDB: ECK120003550
ECOCYC: G6962
ASAP: ABE-0005910
UniProt: P76230
Position
complement(1858850..1860229)
AA seq 459 aa
MEQITKPHCGARLDRLPDCRWHSSMFAIVAFGLLVCWSNAVGGLILAQLKALGWTDNSTT
ATFSAITTAGMFLGALVGGIIGDKTGRRNAFILYEAIHIASMVVGAFSPNMDFLIACRFV
MGVGLGALLVTLFAGFTEYMPGRNRGTWSSRVSFIGNWSYPLCSLIAMGLTPLISAEWNW
RVQLLIPAILSLIATALAWRYFPESPRWLESRGRYQEAEKVMRSIEEGVIRQTGKPLPPV
VIADDGKAPQAVPYSALLTGVLLKRVILGSCVLIAMNVVQYTLINWLPTIFMTQGINLKD
SIVLNTMSMFGAPFGIFIAMLVMDKIPRKTMGVGLLILIAVLGYIYSLQTSMLLITLIGF
FLITFVYMYVCYASAVYVPEIWPTEAKLRGSGLANAVGRISGIAAPYAVAVLLSSYGVTG
VFILLGAVSIIVAIAIATIGIETKGVSVESLSIDAVANK
NT seq 1380 nt   +upstreamnt  +downstreamnt
atggaacagataacaaaaccgcattgtggtgcacggctggatcgcttaccggattgccgc
tggcattcatcaatgtttgccatcgtcgcgtttggcttgcttgtctgctggagtaatgcc
gttggtggcttgatcctcgcgcagctgaaagcgttgggctggacagataattccaccaca
gccacattctcagcaatcacgaccgccggaatgtttctcggtgcgctggtgggcggcatc
attggcgacaaaaccggtcgcagaaatgcgttcatcctctatgaggccattcatattgcc
tcgatggttgtcggtgctttctcaccgaatatggatttccttattgcctgccgttttgtg
atgggagttgggctgggagctttactggttacgctgtttgctggtttcaccgaatatatg
cccggtagaaatcgtggaacgtggtcaagtcgggtttcctttattggcaactggtcatat
ccgctctgttcattgatagcgatgggactcacgccgctgattagtgcagagtggaactgg
cgggtacaactgcttatccctgcaatattgtcgcttatcgctacggcgctggcctggcgc
tactttcctgaatccccgcgctggctggaatcgcgcggacggtatcaggaagccgagaaa
gtcatgcggagtatagaagaaggcgtcatacgccagacgggtaaacctttgccgcctgtg
gttattgctgatgacggtaaagcgccacaagcggtgccgtattcagccttactgacagga
gtattactgaaacgcgtgatattaggctcttgtgtgctgattgccatgaacgttgtgcag
tacacactaattaactggttgccaacaatattcatgacccaggggattaatttaaaagac
tcgattgttttaaataccatgagtatgtttggcgcgccatttggtatttttattgccatg
ctggtgatggataaaattccgcgtaaaacaatgggtgtggggctattaatcctgattgcg
gtgctcggatatatctattcactgcaaaccagtatgttgctcataacgttgattggtttc
ttcctgattactttcgtctatatgtacgtttgctatgcctcggcagtgtatgtccctgaa
atctggccgacagaggccaaactccgtggctccggtctggcgaatgcggtagggcgaatc
agtggtattgccgcaccttatgccgttgcagtgctgctcagtagttatggcgttacggga
gtctttattcttctgggggcggtttcaattattgtcgcaattgctatcgccaccattgga
atcgaaaccaaaggtgtctccgttgaaagtttaagtattgatgcagtagccaataaataa

DBGET integrated database retrieval system