KEGG   Escherichia coli K-12 MG1655: b1791
Entry
b1791             CDS       T00007                                 
Symbol
nimT
Name
(RefSeq) 2-nitroimidazole exporter
  KO
K25494  MFS transporter, CP family, 2-nitroimidazole transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b1791 (nimT)
Transporters [BR:eco02000]
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Cyanate porter (CP) family [TC:2.A.1.17]
    b1791 (nimT)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 946309
NCBI-ProteinID: NP_416305
Pasteur: yeaN
RegulonDB: ECK120003564
ASAP: ABE-0005962
UniProt: P76242
Position
1875673..1876854
AA seq 393 aa
MTCSTSLSGKNRIVLIAGILMIATTLRVTFTGAAPLLDTIRSAYSLTTAQTGLLTTLPLL
AFALISPLAAPVARRFGMERSLFAALLLICAGIAIRSLPSPYLLFGGTAVIGGGIALGNV
LLPGLIKRDFPHSVARLTGAYSLTMGAAAALGSAMVVPLALNGFGWQGALLMLMCFPLLA
LFLWLPQWRSQQHANLSTSRALHTRGIWRSPLAWQVTLFLGINSLVYYVIIGWLPAILIS
HGYSEAQAGSLHGLLQLATAAPGLLIPLFLHHVKDQRGIAAFVALMCAVGAVGLCFMPAH
AITWTLLFGFGSGATMILGLTFIGLRASSAHQAAALSGMAQSVGYLLAACGPPLMGKIHD
ANGNWSVPLMGVAILSLLMAIFGLCAGRDKEIR
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgacctgttcaacttcattaagcggcaaaaacaggattgtccttatcgctggcattctg
atgattgccacaacattacgcgtcacctttaccggcgcagcaccgttactggatacgatt
cgttccgcttactcgctgacgacagcgcaaaccggcttattgaccaccctgccattattg
gcctttgcgctaatctcacctttggctgccccggtagcgcgacgttttggtatggaacgt
agcctgtttgccgcgttacttttgatctgtgctggtatcgcaattcgctctctcccttcg
ccttacttattatttggcggtacagcggtcattggcggtgggattgcattaggcaatgtc
ttactgccaggattaattaaacgcgatttccctcattccgtcgccagacttaccggcgca
tattccctgacaatgggagctgcagcggcactgggatcggctatggtcgtgccgctggct
ttgaacggttttggctggcaaggcgcgttgctcatgctgatgtgttttcctctgctggct
ctttttttatggctgccacagtggcgaagtcaacaacatgcaaatttgagtacctcgcgc
gccttacatactcggggtatctggcgttcaccgcttgcctggcaggtcacattgtttctt
gggatcaactcactggtctattacgtgattattggctggcttccggcgatcctcatcagt
cacggctatagcgaagcacaggcgggttcactgcatggtttgctgcaactagccacagca
gcacccggtttgctgatcccacttttcttacatcatgtgaaagatcagcgtggtattgca
gcgttcgttgccttgatgtgcgcagtgggcgcggttgggctctgctttatgccagcgcac
gcgatcacctggactctgcttttcggttttggttccggcgcaacaatgatactggggttg
acgttcattggtctgcgggctagttctgcgcatcaggcggcggcactctcggggatggca
caatccgtcgggtatttgttggcagcctgtgggccgccgctgatgggtaaaatacacgat
gctaacggtaactggtctgtaccacttatgggtgttgccatactttcactactgatggcg
attttcggactttgcgccgggagagacaaagaaattcgctaa

DBGET integrated database retrieval system