KEGG   Escherichia coli K-12 MG1655: b1854Help
Entry
b1854             CDS       T00007                                 

Gene name
pykA
Definition
(RefSeq) pyruvate kinase II
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00010  Glycolysis / Gluconeogenesis
eco00230  Purine metabolism
eco00620  Pyruvate metabolism
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01120  Microbial metabolism in diverse environments
eco01130  Biosynthesis of antibiotics
eco01200  Carbon metabolism
eco01230  Biosynthesis of amino acids
Module
eco_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eco_M00002  Glycolysis, core module involving three-carbon compounds
eco_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
eco_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    b1854 (pykA)
   00620 Pyruvate metabolism
    b1854 (pykA)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    b1854 (pykA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eco04131]
    b1854 (pykA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eco04147]
    b1854 (pykA)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     b1854 (pykA)
Membrane trafficking [BR:eco04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    b1854 (pykA)
Exosome [BR:eco04147]
 Exosomal proteins
  Proteins found in most exosomes
   b1854 (pykA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C
Motif
Other DBs
NCBI-GeneID: 946527
NCBI-ProteinID: NP_416368
Pasteur: pykA
RegulonDB: ECK120000794
ECOCYC: EG10803
ASAP: ABE-0006182
UniProt: P21599
Position
1937649..1939091
Genome map
AA seq 480 aa AA seqDB search
MSRRLRRTKIVTTLGPATDRDNNLEKVIAAGANVVRMNFSHGSPEDHKMRADKVREIAAK
LGRHVAILGDLQGPKIRVSTFKEGKVFLNIGDKFLLDANLGKGEGDKEKVGIDYKGLPAD
VVPGDILLLDDGRVQLKVLEVQGMKVFTEVTVGGPLSNNKGINKLGGGLSAEALTEKDKA
DIKTAALIGVDYLAVSFPRCGEDLNYARRLARDAGCDAKIVAKVERAEAVCSQDAMDDII
LASDVVMVARGDLGVEIGDPELVGIQKALIRRARQLNRAVITATQMMESMITNPMPTRAE
VMDVANAVLDGTDAVMLSAETAAGQYPSETVAAMARVCLGAEKIPSINVSKHRLDVQFDN
VEEAIAMSAMYAANHLKGVTAIITMTESGRTALMTSRISSGLPIFAMSRHERTLNLTALY
RGVTPVHFDSANDGVAAASEAVNLLRDKGYLMSGDLVIVTQGDVMSTVGSTNTTRILTVE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtccagaaggcttcgcagaacaaaaatcgttaccacgttaggcccagcaacagatcgc
gataataatcttgaaaaagttatcgcggcgggtgccaacgttgtacgtatgaacttttct
cacggctcgcctgaagatcacaaaatgcgcgcggataaagttcgtgagattgccgcaaaa
ctggggcgtcatgtggctattctgggtgacctccaggggcccaaaatccgtgtatccacc
tttaaagaaggcaaagttttcctcaatattggggataaattcctgctcgacgccaacctg
ggtaaaggtgaaggcgacaaagaaaaagtcggtatcgactacaaaggcctgcctgctgac
gtcgtgcctggtgacatcctgctgctggacgatggtcgcgtccagttaaaagtactggaa
gttcagggcatgaaagtgttcaccgaagtcaccgtcggtggtcccctctccaacaataaa
ggtatcaacaaacttggcggcggtttgtcggctgaagcgctgaccgaaaaagacaaagca
gacattaagactgcggcgttgattggcgtagattacctggctgtctccttcccacgctgt
ggcgaagatctgaactatgcccgtcgcctggcacgcgatgcaggatgtgatgcgaaaatt
gttgccaaggttgaacgtgcggaagccgtttgcagccaggatgcaatggatgacatcatc
ctcgcctctgacgtggtaatggttgcacgtggcgacctcggtgtggaaattggcgacccg
gaactggtcggcattcagaaagcgttgatccgtcgtgcgcgtcagctaaaccgagcggta
atcacggcgacccagatgatggagtcaatgattactaacccgatgccgacgcgtgcagaa
gtcatggacgtagcaaacgccgttctggatggtactgacgctgtgatgctgtctgcagaa
actgccgctgggcagtatccgtcagaaaccgttgcagccatggcgcgcgtttgcctgggt
gcggaaaaaatcccgagcatcaacgtttctaaacaccgtctggacgttcagttcgacaat
gtggaagaagctattgccatgtcagcaatgtacgcagctaaccacctgaaaggcgttacg
gcgatcatcaccatgaccgaatcgggtcgtaccgcgctgatgacctcccgtatcagctct
ggtctgccaattttcgccatgtcgcgccatgaacgtacgctgaacctgactgctctctat
cgtggcgttacgccggtgcactttgatagcgctaatgacggcgtagcagctgccagcgaa
gcggttaatctgctgcgcgataaaggttacttgatgtctggtgacctggtgattgtcacc
cagggcgacgtgatgagtaccgtgggttctactaataccacgcgtattttaacggtagag
taa

DBGET integrated database retrieval system