KEGG   Escherichia coli K-12 MG1655: b1880Help
Entry
b1880             CDS       T00007                                 

Gene name
flhB
Definition
(RefSeq) flagellar biosynthesis protein FlhB
  KO
K02401  flagellar biosynthetic protein FlhB
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:eco00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    b1880 (flhB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eco02044]
    b1880 (flhB)
   02035 Bacterial motility proteins [BR:eco02035]
    b1880 (flhB)
Secretion system [BR:eco02044]
 Type III secretion system
  Flagellar export apparatus
   b1880 (flhB)
Bacterial motility proteins [BR:eco02035]
 Flagellar system
  Flagellar assembly proteins
   Type-III secretion
    b1880 (flhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_export_2
Motif
Other DBs
NCBI-GeneID: 946391
NCBI-ProteinID: NP_416394
Pasteur: flhB
RegulonDB: ECK120003615
ECOCYC: G7028
ASAP: ABE-0006275
UniProt: P76299 A0A387CVV2
Position
complement(1965043..1966191)
Genome map
AA seq 382 aa AA seqDB search
MSDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVSLARRLSGML
SAGLHFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL
QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT
AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK
GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI
REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLKRWRLAGGQRP
VQPTHLPVPEALDFINEKPTHE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgacgagagcgacgacaaaacagaagcccccacacctcaccgactagaaaaagcg
cgggaagaggggcaaatcccgcgttcccgtgaactgacctcactgctgattttgctggtg
ggcgttagtgttatctggtttggcggtgtgtcgctggcccgtcgattgtcgggcatgctc
tccgctgggctgcattttgatcacagtattatcaatgacccgaatctgatcctcgggcag
attattctgctgatcagagaagccatgctggcgctgctgccgctgattagcggcgtggtg
ctggtggcgctcatttctccggtcatgctgggagggctggtatttagcggcaaatccttg
cagccgaagttttccaaactcaacccgctaccgggcattaaacggatgttctcggctcag
actggcgcggagttgcttaaagcaattttgaaaaccatcctggttggcagcgtgacgggg
ttttttctctggcatcactggccgcagatgatgcgcttgatggccgagtctccgattacc
gccatgggtaatgcgatggatttggtagggctatgcgcactgctggtggtgcttggtgtc
attccaatggtgggatttgacgtctttttccaaatattcagccacctgaaaaagctgcgt
atgtcacggcaggatattcgtgatgagttcaaacaaagcgaaggtgaccctcatgttaaa
gggcggatccgtcagatgcagcgagctgctgcacggcgtcggatgatggccgatgtgccg
aaagcggatgtcattgtcaataacccgacccactattcggtagcgttgcagtatgacgaa
aacaaaatgagcgcaccgaaagtggtcgctaaaggtgcagggctggtcgcgctgcgcatt
cgtgaaattggcgctgaaaataacgtcccgacgcttgaagcgccgccgctggcgcgagcg
ctgtatcgacatgcggagattggtcaacaaatcccgggtcaactgtacgccgcggtggcg
gaagtgctggcctgggtctggcaactgaaacgctggcgtctggctggtggacagcgccct
gtacaacctactcatcttccggtgccggaagccctggattttattaacgagaaaccgacc
catgagtaa

DBGET integrated database retrieval system