KEGG   Escherichia coli K-12 MG1655: b1917Help
Entry
b1917             CDS       T00007                                 

Gene name
tcyN
Definition
(RefSeq) cystine ABC transporter ATP binding subunit
  KO
K10010  L-cystine transport system ATP-binding protein [EC:7.4.2.1]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b1917 (tcyN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b1917 (tcyN)
Enzymes [BR:eco01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     b1917 (tcyN)
Transporters [BR:eco02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    b1917 (tcyN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_16 ABC_ATPase AAA_29 AAA_13 AAA_33 AAA_15 AAA_23 ATPase_2 AAA_30 AAA_24 cobW NACHT AAA_28 AAA RsgA_GTPase AAA_17 AAA_25 G-alpha NB-ARC AAA_14 AAA_18 T2SSE PduV-EutP AAA_7 SbcCD_C MobB AAA_19 PRK Pox_A32 AAA_35 MMR_HSR1 AAA_5 Roc ATP_bind_1 Rad17
Motif
Other DBs
NCBI-GeneID: 946422
NCBI-ProteinID: NP_416427
Pasteur: yecC
RegulonDB: ECK120002221
ASAP: ABE-0006384
UniProt: P37774
Position
complement(1997062..1997814)
Genome map
AA seq 250 aa AA seqDB search
MSAIEVKNLVKKFHGQTVLHGIDLEVKPGEVVAIIGPSGSGKTTLLRSINLLEQPEAGTI
TVGDITIDTARSLSQQKSLIRQLRQHVGFVFQNFNLFPHRTVLENIIEGPVIVKGEPKEE
ATARARELLAKVGLAGKETSYPRRLSGGQQQRVAIARALAMRPEVILFDEPTSALDPELV
GEVLNTIRQLAQEKRTMVIVTHEMSFARDVADRAIFMDQGRIVEQGAAKALFADPEQPRT
RQFLEKFLLQ
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccattgaagttaagaacctggtgaaaaaattccacggtcagacggtgctgcac
ggtatcgaccttgaggtaaagcctggcgaagtggtggcaattatcggtccgagtggttcc
ggcaaaaccacgttgctacgcagcataaatctgctggaacaacccgaagcgggaacgatc
accgttggcgatatcactattgatactgcacgttcattaagtcagcaaaaatctctgatt
cgccagttgcgtcagcacgtcgggtttgtcttccagaactttaatttgtttccgcatcgt
acggtgctggagaacattattgaagggccggtgatcgtcaaaggtgaaccgaaagaagag
gccacggcgcgcgctcgcgagctgctggcaaaagttgggctggcaggtaaagaaaccagc
tatccacgtcgtttgtctggcggtcaacagcagcgtgttgcgattgcgcgtgcgctggca
atgcgtcctgaggtgattttgtttgacgagccaacgtcagcgctggatccagagctggtg
ggtgaagtcctgaacaccatccgtcagctggcgcaggaaaagcgcacgatggtgattgtg
acgcacgaaatgagctttgcccgggatgttgcggaccgggcgatctttatggaccagggg
cggatagtcgagcagggggccgcaaaagcgttatttgccgaccccgagcagcctcgcacc
cgccagttcctcgagaagtttctgctgcaataa

DBGET integrated database retrieval system