KEGG   Escherichia coli K-12 MG1655: b1918Help
Entry
b1918             CDS       T00007                                 

Gene name
tcyL
Definition
(RefSeq) cystine ABC transporter membrane subunit
  KO
K10009  L-cystine transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Module
eco_M00234  L-Cystine transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b1918 (tcyL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b1918 (tcyL)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter [MD:M00234]
    b1918 (tcyL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-GeneID: 949105
NCBI-ProteinID: NP_416428
Pasteur: yecS
RegulonDB: ECK120003623
ASAP: ABE-0006386
UniProt: P0AFT2 A0A387D7F0
Position
complement(1997811..1998479)
Genome map
AA seq 222 aa AA seqDB search
MQESIQLVIDSLPFLLKGAGYTLQLSIGGMFFGLLLGFILALMRLSPIWPVRWLARFYIS
IFRGTPLIAQLFMIYYGLPQFGIELDPIPSAMIGLSLNTAAYAAETLRAAISSIDKGQWE
AAASIGMTPWQTMRRAILPQAARVALPPLSNSFISLVKDTSLAATIQVPELFRQAQLITS
RTLEVFTMYLAASLIYWIMATVLSTLQNHFENQLNRQEREPK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaagtatacaactggttattgattccttgccgttcctgctgaaaggggctggg
tatacgctgcaactcagtatcggcggcatgttttttggcttactgctcgggtttattctc
gcgctgatgcgtctgtcgccaatctggcccgtgcgctggctggcgcgtttttatatctct
atttttcgtggtacgccgctcatcgcacaactgtttatgatctattacggcctgccgcag
tttggtatcgaattagatcccattccgtcagcaatgattggtctgtcgttgaacactgcc
gcctatgctgccgaaacgctgcgcgccgccatttcttctattgataaaggtcagtgggaa
gcggcagccagtattggtatgacgccgtggcagaccatgcgtcgcgcgattttgccacag
gcggcgcgtgtggcgttgccgccgctgtcgaacagctttattagcctggtaaaagatacg
tcgctggccgcgacaatccaggtgccggagctgttccgtcaggcgcagttgattacctcg
cgtacgctggaggtgttcaccatgtatctggcggcttcgctcatctactggatcatggcg
actgtgttatcgacgttgcagaaccattttgagaatcaacttaatcgccaggagagagaa
ccaaaatga

DBGET integrated database retrieval system