KEGG   Escherichia coli K-12 MG1655: b1981
Entry
b1981             CDS       T00007                                 
Symbol
shiA
Name
(RefSeq) shikimate:H(+) symporter
  KO
K08172  MFS transporter, MHS family, shikimate and dehydroshikimate transport protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b1981 (shiA)
Transporters [BR:eco02000]
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Metabolite:H+ symporter (MHS) family [TC:2.A.1.6]
    b1981 (shiA)
SSDB
Motif
Pfam: MFS_1 Sugar_tr
Other DBs
NCBI-GeneID: 946495
NCBI-ProteinID: NP_416488
Pasteur: shiA
RegulonDB: ECK120003653
ECOCYC: G7067
ASAP: ABE-0006572
UniProt: P76350
Position
2053643..2054959
AA seq 438 aa
MDSTLISTRPDEGTLSLSRARRAALGSFAGAVVDWYDFLLYGITAALVFNREFFPQVSPA
MGTLAAFATFGVGFLFRPLGGVIFGHFGDRLGRKRMLMLTVWMMGIATALIGILPSFSTI
GWWAPILLVTLRAIQGFAVGGEWGGAALLSVESAPKNKKAFYSSGVQVGYGVGLLLSTGL
VSLISMMTTDEQFLSWGWRIPFLFSIVLVLGALWVRNGMEESAEFEQQQHYQAAAKKRIP
VIEALLRHPGAFLKIIALRLCELLTMYIVTAFALNYSTQNMGLPRELFLNIGLLVGGLSC
LTIPCFAWLADRFGRRRVYITGTLIGTLSAFPFFMALEAQSIFWIVFFSIMLANIAHDMV
VCVQQPMFTEMFGASYRYSGAGVGYQVASVVGGGFTPFIAAALITYFAGNWHSVAIYLLA
GCLISAMTALLMKDSQRA
NT seq 1317 nt   +upstreamnt  +downstreamnt
atggactccacgctcatctccactcgtcccgatgaagggacgctttcgttaagtcgcgcc
cgacgagctgcgttaggcagcttcgctggtgccgtcgtcgactggtatgattttttactc
tatggcatcaccgccgcactggtgtttaatcgcgagtttttcccgcaagtaagcccggcg
atgggaacgctcgccgcatttgctacctttggcgtcggatttcttttccgtccgctcggc
ggtgtcattttcggtcactttggcgaccgactgggacgtaagcgcatgttaatgctgacc
gtctggatgatgggcatcgcgacagccttgattggtattcttccttcattctcgaccatt
gggtggtgggcacctattttgctggtgacactgcgtgccattcagggatttgcagtcggc
ggcgaatggggaggcgcggcgttgctttccgttgaaagtgcaccgaaaaataaaaaagcc
ttttacagtagcggtgtacaagttggctacggtgtaggtttactgctttcaaccggactg
gtttcattgatcagtatgatgacgactgacgaacagtttttaagctggggctggcgcatt
cctttcctgtttagcatcgtactggtactgggagcattgtgggtgcgcaatggcatggag
gagtccgcggaatttgaacaacagcaacattatcaagctgccgcgaaaaaacgcatcccg
gttatcgaagcgctgttacgacatcccggtgctttcctgaagattattgcgctacgactg
tgcgaattgctgacgatgtacatcgttactgcctttgcacttaattattcaacccagaat
atggggctaccgcgcgaacttttccttaatattggtttgctggtaggtggattaagctgc
ctgacaattccctgttttgcctggcttgccgatcgttttggtcgccgtagggtttatatc
acaggtacgttaatcggaacgttgagcgcatttcctttctttatggcgcttgaagcacaa
tctattttctggatagttttcttctccataatgctggcaaacattgcgcatgacatggtg
gtgtgtgtgcaacaaccgatgtttaccgaaatgtttggtgccagttatcgctatagtggc
gctggagtcggttatcaggttgccagtgtggttggcggtggatttacaccttttattgcc
gctgcactcatcacttactttgccgggaactggcatagcgtcgccatttatttgctggct
ggatgcctgatttccgcaatgaccgctttgttgatgaaagacagtcaacgcgcttga

DBGET integrated database retrieval system