KEGG   Escherichia coli K-12 MG1655: b1983Help
Entry
b1983             CDS       T00007                                 

Gene name
yeeN
Definition
(RefSeq) putative transcriptional regulator YeeN
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transcrip_reg
Motif
Other DBs
NCBI-GeneID: 946493
NCBI-ProteinID: NP_416490
Pasteur: yeeN
RegulonDB: ECK120003654
ECOCYC: G7068
ASAP: ABE-0006582
UniProt: P0A8A2
Position
2056858..2057574
Genome map
AA seq 238 aa AA seqDB search
MGRKWANIVAKKTAKDGATSKIYAKFGVEIYAAAKQGEPDPELNTSLKFVIERAKQAQVP
KHVIDKAIDKAKGGGDETFVQGRYEGFGPNGSMIIAETLTSNVNRTIANVRTIFNKKGGN
IGAAGSVSYMFDNTGVIVFKGTDPDHIFEILLEAEVDVRDVTEEEGNIVIYTEPTDLHKG
IAALKAAGITEFSTTELEMIAQSEVELSPEDLEIFEGLVDALEDDDDVQKVYHNVANL
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
gtgggacgtaaatgggccaatattgttgctaaaaaaacggctaaagacggtgcaacgtct
aaaatttatgcaaaattcggtgtagaaatctatgctgctgctaaacaaggtgaacccgat
ccagaattaaacacatctttaaaattcgttattgaacgtgcaaagcaggcacaagttcca
aagcacgttattgataaagcaattgataaagccaaaggcggcggagatgaaacgttcgtg
cagggacgttatgaaggctttggtcctaatggctcaatgattatcgccgagacattgact
tcaaatgttaaccgtacgattgctaacgttcgcacaattttcaataaaaaaggcggcaat
atcggagcggcaggttctgtcagctatatgtttgacaatacgggtgtgattgtatttaaa
gggacagaccctgaccatatttttgaaattttacttgaagctgaagttgatgttcgtgat
gtgactgaagaagaaggtaacattgttatttatactgaacctactgaccttcataaagga
atcgcggctctaaaagcagctggaatcactgagttctcaacaacagaattagaaatgatt
gctcaatctgaagttgagctttccccagaagatttagaaatctttgaagggcttgttgat
gcccttgaagatgacgacgatgtacaaaaagtttatcataacgtcgcaaatctctaa

DBGET integrated database retrieval system