KEGG   Escherichia coli K-12 MG1655: b1985Help
Entry
b1985             CDS       T00007                                 

Gene name
yeeO
Definition
(RefSeq) FMN/FAD exporter
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MatE
Motif
Other DBs
NCBI-GeneID: 946506
NCBI-ProteinID: NP_416491
RegulonDB: ECK120003656
ECOCYC: G7070
ASAP: ABE-0006586
UniProt: P76352 A0A387D0A2
Position
complement(2058203..2059846)
Genome map
AA seq 547 aa AA seqDB search
MLRHILTAKNLLSNPIFKFPNCLPFLSTVCCICRQFVGENLCSFADSPSLFEMWFHFLQL
RSALNISSALRQVVHGTRWHAKRKSYKVLFWREITPLAVPIFMENACVLLMGVLSTFLVS
WLGKDAMAGVGLADSFNMVIMAFFAAIDLGTTVVVAFSLGKRDRRRARVATRQSLVIMTL
FAVLLATLIHHFGEQIIDFVAGDATTEVKALALTYLELTVLSYPAAAITLIGSGALRGAG
NTKIPLLINGSLNILNIIISGILIYGLFSWPGLGFVGAGLGLTISRYIGAVAILWVLAIG
FNPALRISLKSYFKPLNFSIIWEVMGIGIPASVESVLFTSGRLLTQMFVAGMGTSVIAGN
FIAFSIAALINLPGSALGSASTIITGRRLGVGQIAQAEIQLRHVFWLSTLGLTAIAWLTA
PFAGVMASFYTQDPQVKHVVVILIWLNALFMPIWSASWVLPAGFKGARDARYAMWVSMLS
MWGCRVVVGYVLGIMLGWGVVGVWMGMFADWAVRAVLFYWRMVTGRWLWKYPRPEPQKCE
KKPVVSE
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
ttgttgaggcacatcttaacggcgaaaaatcttttgtcaaacccgatttttaaattcccc
aactgtttgccgtttctatcaacagtttgttgcatttgcagacaatttgttggcgaaaat
ctttgcagctttgctgattctccctcattatttgaaatgtggtttcactttctgcaatta
aggtcggctttgaatatctcctctgctttacgccaggttgttcacggcactcgctggcac
gctaaacgcaagagctacaaagtgttgttctggcgcgagataaccccgcttgctgttcct
atcttcatggagaatgcctgtgtcctgttgatgggggttctgagcacttttctggtcagc
tggctgggaaaagatgcgatggccggcgtgggattggcggacagcttcaatatggtcatt
atggctttttttgctgctatcgatcttggtactactgtcgttgtggcatttagtctcggt
aagcgggatcgacgacgagcgagggtggcgacgcggcagtcattggtgatcatgacgttg
tttgccgtactgttggcaacgcttattcatcattttggcgaacaaattattgatttcgtc
gcgggtgatgccacgacagaagttaaagcactggcgttgacttatctggagctgacggta
ctcagttatccagcagctgccatcactcttattggtagcggggcacttcgtggtgcaggg
aatacgaaaataccgctattgattaacggtagcctgaatattcttaatattattattagc
ggcatattgatttacggccttttctcctggccgggactgggatttgtcggggcagggctg
ggtttaaccatttctcgttatattggcgcagttgcaattttgtgggtgctggcgattggt
tttaatcctgcgctaaggatttcgttaaagagctattttaaaccgctgaattttagcatt
atctgggaagtcatggggattggtattcccgcgagtgtcgaatcagtgttatttaccagt
ggtcggttattaacccaaatgttcgttgccgggatggggaccagtgttattgccggaaat
tttatcgcgttttcaattgcggctcttatcaacttacccggaagtgcgctcggctctgct
tctacgatcattacaggccgaaggttgggggtagggcagatagcgcaagcagagattcag
ttgcggcatgtgttctggctttccactcttggattaacggccatcgcctggctaacggct
ccctttgccggggttatggcatcgttttacacccaggatccacaggttaaacatgtcgtt
gtgattctgatttggctaaatgctttatttatgcctatttggtccgcctcatgggtgcta
cccgctggatttaaaggtgctcgtgatgcccgttacgccatgtgggtttcgatgttgagc
atgtggggttgtcgggttgtagtcggttatgtgctgggaatcatgcttggctggggtgtg
gttggtgtctggatgggaatgtttgccgactgggctgtgcgggccgtgctgttttactgg
cgaatggttactggacgttggctatggaaataccctcgacccgagccgcaaaagtgtgaa
aaaaagccagttgtgtcggaataa

DBGET integrated database retrieval system