KEGG   Escherichia coli K-12 MG1655: b1996Help
Entry
b1996             CDS       T00007                                 

Gene name
insD-3
Definition
(RefSeq) CP4-44 prophage; IS2 insertion element protein InsB
  KO
K07497  putative transposase
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    b1996 (insD-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: rve rve_3 HTH_21
Motif
Other DBs
NCBI-GeneID: 946403
NCBI-ProteinID: NP_416500
RegulonDB: ECK120003662
ASAP: ABE-0006629
UniProt: P0CF53 P0CF54 P0CF55 P0CF56 P0CF57 P0CF58
Position
complement(2068952..2069857)
Genome map
AA seq 301 aa AA seqDB search
MDSARALIARGWGVSLVSRCLRVSRAQLHVILRRTDDWMDGRRSRHTDDTDVLLRIHHVI
GELPTYGYRRVWALLRRQAELDGMPAINAKRVYRIMRQNALLLERKPAVPPSKRAHTGRV
AVKESNQRWCSDGFEFCCDNGERLRVTFALDCCDREALHWAVTTGGFNSETVQDVMLGAV
ERRFGNDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNTAVRSPESNGIAESFVKTI
KRDYISIMPKPDGLTAAKNLAEAFEHYNEWHPHSALGYRSPREYLRQRACNGLSDNRCLE
I
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtggatagcgcacgcgcccttattgcccggggatggggagtaagcttagtcagccgttgt
ctccgggtgtcgcgtgcgcagttgcacgtcattctcagacgaaccgatgactggatggat
ggccgccgcagtcgtcacactgatgatacggatgtgcttctccgtatacaccatgttatc
ggagagctgccaacgtatggttatcgtcgggtatgggcgctgcttcgcagacaggcagaa
cttgatggtatgcctgcgatcaatgccaaacgtgtttaccggatcatgcgccagaatgcg
ctgttgcttgagcgaaaacctgctgtaccgccatcgaaacgggcacatacaggcagagtg
gccgtgaaagaaagcaatcagcgatggtgctctgacgggttcgagttctgctgtgataac
ggagagagactgcgtgtcacgttcgcgctggactgctgtgatcgtgaggcactgcactgg
gcggtcactaccggcggcttcaacagtgaaacagtacaggacgtcatgctgggagcggtg
gaacgccgcttcggcaacgatcttccgtcgtctccagtggagtggctgacggataatggt
tcatgctaccgggctaatgaaacacgccagttcgcccggatgttgggacttgaaccgaag
aacacggcggtgcggagtccggagagtaacggaatagcagagagcttcgtgaaaacgata
aagcgtgactacatcagtatcatgcccaaaccagacgggttaacggcagcaaagaacctt
gcagaggcgttcgagcattataacgaatggcatccgcatagtgcgctgggttatcgctcg
ccacgggaatatctgcggcagcgggcttgtaatgggttaagtgataacagatgtctggaa
atatag

DBGET integrated database retrieval system