KEGG   Escherichia coli K-12 MG1655: b2025
Entry
b2025             CDS       T00007                                 

Gene name
hisF
Definition
(RefSeq) imidazole glycerol phosphate synthase subunit HisF
  KO
K02500  imidazole glycerol-phosphate synthase subunit HisF [EC:4.3.2.10]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00340  Histidine metabolism
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01230  Biosynthesis of amino acids
Module
eco_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    b2025 (hisF)
Enzymes [BR:eco01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.10  imidazole glycerol-phosphate synthase
     b2025 (hisF)
SSDB
Motif
Pfam: His_biosynth Dus NMO ThiG TMP-TENI FMN_dh G3P_antiterm Oxidored_FMN IMPDH
Other DBs
NCBI-GeneID: 946516
NCBI-ProteinID: NP_416529
Pasteur: hisF
RegulonDB: ECK120000441
ECOCYC: EG10448
ASAP: ABE-0006727
UniProt: P60664
Position
2095844..2096620
AA seq 258 aa
MLAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRV
VDKSWVSRVAEVIDIPFCVAGGIKSLEDAAKILSFGADKISINSPALADPTLITRLADRF
GVQCIVVGIDTWYDAETGKYHVNQYTGDESRTRVTQWETLDWVQEVQKRGAGEIVLNMMN
QDGVRNGYDLEQLKKVREVCHVPLIASGGAGTMEHFLEAFRDADVDGALAASVFHKQIIN
IGELKAYLATQGVEIRIC
NT seq 777 nt   +upstreamnt  +downstreamnt
atgctggcaaaacgcataatcccatgtctcgacgttcgtgatggtcaggtggtgaaaggc
gtacagtttcgcaaccatgaaatcattggcgatatcgtgccgctggcaaaacgctacgct
gaagaaggcgctgacgaactggtgttctacgatatcaccgcttccagcgatggccgtgtg
gtagataaaagctgggtatctcgcgtggcggaagtgatcgacattccgttttgtgtggcg
ggtgggattaagtctctggaagatgccgcgaaaattctttcctttggcgcggataaaatt
tccatcaactctcctgcgctggcagacccaacattaattactcgcctggccgatcgcttt
ggcgtgcagtgtattgtggtcggtattgatacctggtacgacgccgaaaccggtaaatat
catgtgaatcaatataccggcgatgaaagccgcacccgcgtcactcaatgggaaacgctc
gactgggtacaggaagtgcaaaaacgcggtgccggagaaatcgtcctcaatatgatgaat
caggacggcgtgcgtaacggttacgacctcgaacaactgaaaaaagtgcgtgaagtttgc
cacgtcccgctgattgcctccggtggcgcgggcaccatggaacacttcctcgaagccttc
cgcgatgccgacgttgacggcgcgctggcagcttccgtattccacaaacaaataatcaat
attggtgaattaaaagcgtacctggcaacacagggcgtggagatcaggatatgttaa

DBGET integrated database retrieval system