KEGG   Escherichia coli K-12 MG1655: b2037Help
Entry
b2037             CDS       T00007                                 

Gene name
rfbX
Definition
(RefSeq) polyisoprenol-linked O-antigen repeat unit flippase
  KO
K18799  O-antigen flippase
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:eco01005]
    b2037 (rfbX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b2037 (rfbX)
Lipopolysaccharide biosynthesis proteins [BR:eco01005]
 O-antigen
  b2037 (rfbX)
Transporters [BR:eco02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   b2037 (rfbX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_synt Polysacc_synt_3 Polysacc_synt_C
Motif
Other DBs
NCBI-GeneID: 946557
NCBI-ProteinID: NP_416541
Pasteur: rfbX
RegulonDB: ECK120001905
ASAP: ABE-0006757
UniProt: P37746
Position
complement(2108337..2109584)
Genome map
AA seq 415 aa AA seqDB search
MNTNKLSLRRNVIYLAVVQGSNYLLPLLTFPYLVRTLGPENFGIFGFCQATMLYMIMFVE
YGFNLTATQSIAKAADSKDKVTSIFWAVIFSKIVLIVITLIFLTSMTLLVPEYNKHAVII
WSFVPALVGNLIYPIWLFQGKEKMKWLTLSSILSRLAIIPLTFIFVNTKSDIAIAGFIQS
SANLVAGIIALAIVVHEGWIGKVTLSLHNVRRSLADGFHVFISTSAISLYSTGIVIILGF
ISGPTSVGNFNAANTIRNALQGLLNPITQAIYPRISSTLVLNRVKGVILIKKSLTCLSLI
GGAFSLILLLGASILVKISIGPGYDNAVIVLMIISPLPFLISLSNVYGIQVMLTHNYKKE
FSKILIAAGLLSLLLIFPLTTLFKEIGAAITLLATECLVTSLMLMFVRNNKLLVC
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgaataaattatctttaagaagaaacgttatatatctggctgtcgttcaaggt
agcaattatcttttaccattgcttacatttccatatcttgtaagaacacttggtcctgaa
aatttcggtatattcggtttttgccaagcgactatgctatatatgataatgtttgttgaa
tatggtttcaatctcacagcaactcagagtattgccaaagcagcagatagtaaagataaa
gtaacgtctattttttgggcggtgatattttcaaaaatagttcttatcgtcattacattg
attttcttaacgtcgatgaccttgcttgttcctgaatataacaagcatgccgtaattata
tggtcgtttgttcctgcattagtcgggaatttaatctaccctatctggctgtttcaggga
aaagaaaaaatgaaatggctgactttaagtagtattttatcccgcttggctattatccct
ctaacatttatttttgtgaacacaaagtcagatatagcaattgccggttttattcagtca
agtgcaaatctggttgctggaattattgcactagctatcgttgttcatgaaggttggatt
ggtaaagttacgctatcattacataatgtgcgtcgatctttagcagacggttttcatgtt
tttatttccacatctgctattagtttatattctacgggaatagttattatcctgggattt
atatctggaccaacgtccgtagggaattttaatgcggccaatactataagaaacgcgctt
caagggctattaaatcctatcacccaagcaatatacccaagaatatcaagtacgcttgtt
cttaatcgtgtgaagggtgtgattttaattaaaaaatcattgacctgcttgagtttgatt
ggtggtgctttttcattaattctgctcttgggtgcatctatactagtaaaaataagtata
gggccgggatatgataatgcagtgattgtgctaatgattatatcgcctctgccttttctt
atttcattaagtaatgtctatggcattcaagttatgctgacccataattataagaaagaa
ttcagtaagattttaatcgctgcgggtttgttgagtttgttgttgatttttccgctaaca
actctttttaaagagattggtgcagcaataacattgcttgcaacagagtgcttagttacg
tcactcatgctgatgttcgtaagaaataataaattactggtttgctga

DBGET integrated database retrieval system