KEGG   Escherichia coli K-12 MG1655: b2042
Entry
b2042             CDS       T00007                                 

Gene name
galF
Definition
(RefSeq) UTP:glucose-1-phosphate uridylyltransferase, low activity
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00040  Pentose and glucuronate interconversions
eco00052  Galactose metabolism
eco00500  Starch and sucrose metabolism
eco00520  Amino sugar and nucleotide sugar metabolism
eco00541  O-Antigen nucleotide sugar biosynthesis
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01240  Biosynthesis of cofactors
Module
eco_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
eco_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    b2042 (galF)
   00052 Galactose metabolism
    b2042 (galF)
   00500 Starch and sucrose metabolism
    b2042 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    b2042 (galF)
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    b2042 (galF)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     b2042 (galF)
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3
Other DBs
NCBI-GeneID: 946560
NCBI-ProteinID: NP_416546
Pasteur: galF
RegulonDB: ECK120003679
ASAP: ABE-0006771
UniProt: P0AAB6
Position
complement(2113434..2114327)
AA seq 297 aa
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKLLSE
NT seq 894 nt   +upstreamnt  +downstreamnt
atgacgaatttaaaagcagttattcctgtagcgggtctcgggatgcatatgttgcctgcc
actaaggcgatacccaaagagatgctaccaatcgtcgacaagccaatgattcagtacatt
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcacgcgtccaag
aacgcggtcgaaaaccacttcgacacctcttatgagttagaatcactccttgagcagcgc
gtgaagcgtcaactgctggcggaagtacagtccatctgtccgccgggcgtgaccattatg
aacgtgcgtcagggcgaacctttaggtttaggccactccattttgtgtgcgcgacctgcc
attggtgacaacccatttgtcgtggtactgccagacgttgtgatcgacgatgccagcgcc
gacccgctacgttacaaccttgctgccatgattgcacgtttcaacgaaacgggccgcagc
caggtgctggcaaaacgtatgccgggtgacctctctgaatactccgtcatccagactaaa
gagccgctggaccgtgagggtaaagtcagccgcattgttgaatttatcgaaaaaccggat
cagccgcagacgctggactcagacatcatggccgtaggtcgctatgtgctttctgccgat
atttggccggaactggaacgtactcagcctggtgcatggggacgtattcagctgactgat
gctattgccgagctggcgaaaaaacaatccgttgatgcaatgctgatgaccggcgacagt
tacgactgcggcaaaaaaatgggctatatgcaggcgtttgtgaagtatggcctacgcaac
ctgaaagaaggggcgaagttccgtaaaggtattgagaagctgttaagcgaataa

DBGET integrated database retrieval system