KEGG   Escherichia coli K-12 MG1655: b2046Help
Entry
b2046             CDS       T00007                                 

Gene name
wzxC
Definition
(RefSeq) M-antigen undecaprenyl disphosphate flippase
  KO
K16695  lipopolysaccharide exporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b2046 (wzxC)
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b2046 (wzxC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_synt_3 Polysacc_synt Polysacc_synt_C DUF3153
Motif
Other DBs
NCBI-GeneID: 946581
NCBI-ProteinID: NP_416550
Pasteur: wzxC
RegulonDB: ECK120003683
ECOCYC: G7097
ASAP: ABE-0006783
UniProt: P77377 A0A387D750
Position
complement(2118680..2120158)
Genome map
AA seq 492 aa AA seqDB search
MSLREKTISGAKWSAIATVIIIGLGLVQMTVLARIIDNHQFGLLTVSLVIIALADTLSDF
GIANSIIQRKEISHLELTTLYWLNVGLGIVVCVAVFLLSDLIGDVLNNPDLAPLIKTLSL
AFVVIPHGQQFRALMQKELEFNKIGMIETSAVLAGFTCTVVSAHFWPLAMTAILGYLVNS
AVRTLLFGYFGRKIYRPGLHFSLASVAPNLRFGAWLTADSIINYLNTNLSTLVLARILGA
GVAGGYNLAYNVAVVPPMKLNPIITRVLFPAFAKIQDDTEKLRVNFYKLLSVVGIINFPA
LLGLMVVSNNFVPLVFGEKWNSIIPVLQLLCVVGLLRSVGNPIGSLLMAKARVDISFKFN
VFKTFLFIPAIVIGGQMAGAIGVTLGFLLVQIINTILSYFVMIKPVLGSSYRQYILSLWL
PFYLSLPTLVVSYALGIVLKGQLALGMLLAVQIATGVLAFVVMIVLSRHPLVVEVKRQFC
RSEKMKMLLRAG
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgagcttacgtgaaaaaaccatcagcggcgcgaagtggtcggcgattgccacggtgatc
atcatcggcctcgggctggtgcagatgaccgtgctggcgcggattatcgacaaccaccag
ttcggcctgcttaccgtgtcgctggtgattatcgcgctggcagatacgctttctgacttc
ggtatcgctaactcgattattcagcgaaaagaaatcagtcaccttgaactcaccacgttg
tactggctgaacgtcgggctggggatcgtggtgtgcgtggcggtgtttttgttgagtgat
ctcatcggcgacgtgctgaataacccggacctggcaccgttgattaaaacattatcgctg
gcgtttgtggtaatcccccacgggcaacagttccgcgcgttgatgcaaaaagagctggag
ttcaacaaaatcggcatgatcgaaaccagcgcggtgctggcgggcttcacttgtacggtg
gttagcgcccatttctggccgctggcgatgaccgcgatcctcggttatctggtcaatagt
gcggtgagaacgctgctgtttggctactttggccgcaaaatttatcgccccggtctgcat
ttctcgctggcgtcggtggcaccgaacttacgctttggtgcctggctgacggcggacagc
atcatcaactatctcaataccaacctttcaacgctcgtgctggcgcgtattctcggcgcg
ggcgtggcagggggatacaacctggcgtacaacgtggccgttgtgccaccgatgaagctg
aacccaatcatcacccgcgtgttgtttccggcattcgccaaaattcaggacgataccgaa
aagctgcgtgttaacttctacaagctgctgtcggtagtggggattatcaactttccggcg
ctgctcgggctaatggtggtgtcgaataactttgtaccgctggtctttggtgagaagtgg
aacagcattattccggtgctgcaattgctgtgtgtggtgggtctgctgcgctccgtaggt
aacccgattggttcgctgctgatggcgaaagcgcgggtcgatatcagctttaaattcaac
gtattcaaaacatttctgtttattccggcgattgttataggtgggcagatggcgggcgcg
atcggcgtcacgcttggcttcctgctggtgcaaattatcaacaccattctgagttacttc
gtgatgattaaaccggttcttggttccagttatcgccagtacatcctgagtttatggctg
ccgttttatctctcgctgccgacgctggtggtcagttatgcgctgggcattgtgctgaaa
gggcaactggcgctggggatgctgctggcggtgcaaatagccacgggggtgctggcgttt
gtggtgatgattgtgctgtcgcgccatccgctggtggtggaagtgaagcgtcagttttgt
cgcagcgaaaaaatgaaaatgcttttacgggcggggtga

DBGET integrated database retrieval system