KEGG   Escherichia coli K-12 MG1655: b2052Help
Entry
b2052             CDS       T00007                                 

Gene name
fcl
Definition
(RefSeq) GDP-L-fucose synthase
  KO
K02377  GDP-L-fucose synthase [EC:1.1.1.271]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00051  Fructose and mannose metabolism
eco00520  Amino sugar and nucleotide sugar metabolism
eco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    b2052 (fcl)
   00520 Amino sugar and nucleotide sugar metabolism
    b2052 (fcl)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.271  GDP-L-fucose synthase
     b2052 (fcl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind Polysacc_synt_2 NAD_binding_10 DapB_N
Motif
Other DBs
NCBI-GeneID: 946563
NCBI-ProteinID: NP_416556
Pasteur: fcl
RegulonDB: ECK120001722
ASAP: ABE-0006801
UniProt: P32055
Structure
PDB: 

Position
complement(2126225..2127190)
Genome map
AA seq 321 aa AA seqDB search
MSKQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVY
LAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMA
ESELLQGTLEPTNEPYAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHV
IPALLRRFHEATAQNAPDVVVWGSGTPMREFLHVDDMAAASIHVMELAHEVWLENTQPML
SHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVTRLHQLGWYHEIS
LEAGLASTYQWFLENQDRFRG
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaacaacgagtttttattgctggtcatcgcgggatggtcggttccgccatcagg
cggcagctcgaacagcgcggtgatgtggaactggtattacgcacccgcgacgagctgaac
ctgctggacagccgcgccgtgcatgatttctttgccagcgaacgtattgaccaggtctat
ctggcggcggcgaaagtgggcggcattgttgccaacaacacctatccggcggatttcatc
taccagaacatgatgattgagagcaacatcattcacgccgcgcatcagaacgacgtgaac
aaactgctgtttctcggatcgtcctgcatctacccgaaactggcaaaacagccgatggca
gaaagcgagttgttgcagggcacgctggagccgactaacgagccttatgctattgccaaa
atcgccgggatcaaactgtgcgaatcatacaaccgccagtacggacgcgattaccgctca
gtcatgccgaccaacctgtacgggccacacgacaacttccacccgagtaattcgcatgtg
atcccagcattgctgcgtcgcttccacgaggcgacggcacagaatgcgccggacgtggtg
gtatggggcagcggtacaccgatgcgcgaatttctgcacgtcgatgatatggcggcggcg
agcattcatgtcatggagctggcgcatgaagtctggctggagaacacccagccgatgttg
tcgcacattaacgtcggcacgggcgttgactgcactatccgcgagctggcgcaaaccatc
gccaaagtggtgggttacaaaggccgggtggtttttgatgccagcaaaccggatggcacg
ccgcgcaaactgctggatgtgacgcgcctgcatcagcttggctggtatcacgaaatctca
ctggaagcggggcttgccagcacttaccagtggttccttgagaatcaagaccgctttcgg
gggtaa

DBGET integrated database retrieval system