KEGG   Escherichia coli K-12 MG1655: b2088Help
Entry
b2088             CDS       T00007                                 

Gene name
insE1
Definition
(RefSeq) IS3 transposase A
  KO
K07483  transposase
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    b2088 (insE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_Tnp_1 HTH_23 HTH_28 FAM76 CCDC-167 DUF4005
Motif
Other DBs
NCBI-GeneID: 946616
NCBI-ProteinID: NP_416592
RegulonDB: ECK120003709
ASAP: ABE-0006917
UniProt: P0CF66 P0CF67 P0CF68 P0CF69 P0CF70
Position
2170236..2170535
Genome map
AA seq 99 aa AA seqDB search
MTKTVSTSKKPRKQHSPEFRSEALKLAERIGVTAAARELSLYESQLYNWRSKQQNQQTSS
ERELEMSTEIARLKRQLAERDEELAILQKAATYFAKRLK
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacagtatcaaccagtaaaaaaccccgtaaacagcattcgcctgaatttcgc
agtgaagccctgaagcttgctgaacgcatcggtgttactgccgcagcccgtgaactcagc
ctgtatgaatcacaactctacaactggcgcagtaaacagcaaaatcagcagacgtcttct
gaacgtgaactggagatgtctaccgagattgcacgtctcaaacgccagctggcagaacgg
gatgaagagctggctatcctccaaaaggccgcgacatacttcgcgaagcgcctgaaatga

DBGET integrated database retrieval system