KEGG   Escherichia coli K-12 MG1655: b2143Help
Entry
b2143             CDS       T00007                                 

Gene name
cdd
Definition
(RefSeq) cytidine/deoxycytidine deaminase
  KO
K01489  cytidine deaminase [EC:3.5.4.5]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00240  Pyrimidine metabolism
eco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    b2143 (cdd)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.5  cytidine deaminase
     b2143 (cdd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dCMP_cyt_deam_2 dCMP_cyt_deam_1 MafB19-deam Pput2613-deam
Motif
Other DBs
NCBI-GeneID: 946663
NCBI-ProteinID: NP_416648
Pasteur: cdd
RegulonDB: ECK120000133
ECOCYC: EG10137
ASAP: ABE-0007086
UniProt: P0ABF6
Structure
PDB: 

Position
2231844..2232728
Genome map
AA seq 294 aa AA seqDB search
MHPRFQTAFAQLADNLQSALEPILADKYFPALLTGEQVSSLKSATGLDEDALAFALLPLA
AACARTPLSNFNVGAIARGVSGTWYFGANMEFIGATMQQTVHAEQSAISHAWLSGEKALA
AITVNYTPCGHCRQFMNELNSGLDLRIHLPGREAHALRDYLPDAFGPKDLEIKTLLMDEQ
DHGYALTGDALSQAAIAAANRSHMPYSKSPSGVALECKDGRIFSGSYAENAAFNPTLPPL
QGALILLNLKGYDYPDIQRAVLAEKADAPLIQWDATSATLKALGCHSIDRVLLA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcatccacgttttcaaaccgcttttgcccaacttgcggataacttgcaatctgcactg
gaacctattctggcagacaagtacttccccgctttgttgaccggggagcaagtctcatcg
ctgaagagcgcaacggggctggacgaagacgcgctggcattcgcactacttccgctggcg
gcggcctgtgcgcgtacgccattgtcgaattttaatgttggcgcaattgcgcgcggtgtg
agcggaacctggtatttcggtgccaatatggaatttattggtgcgacaatgcagcaaacc
gttcatgccgaacaaagcgcgatcagccacgcctggttgagtggtgaaaaagcgcttgca
gccatcaccgttaactacacgccttgtggtcactgccgtcagtttatgaatgaactgaac
agcggtctggatctgcgtattcatctgccgggccgcgaggcacacgcgctgcgtgactat
ctgccagatgcctttgggccgaaagatctggagattaaaacgctgctgatggacgaacag
gatcacggctatgcgctgacgggtgatgcgctttctcaggcagcgattgcggcggcaaac
cgttcgcacatgccttacagtaagtcgccaagcggtgtcgcgctggaatgtaaagacggt
cgtattttcagtggcagctacgctgaaaacgccgcattcaacccgactctgccaccgttg
cagggagcgttaattctgttgaatctcaagggttatgattacccggatatccagcgcgcg
gttctggcagaaaaagccgatgcgccgttgattcagtgggatgccacctccgcaacgctg
aaagctctcggctgtcacagtatcgaccgagtgcttctcgcttaa

DBGET integrated database retrieval system