KEGG   Escherichia coli K-12 MG1655: b2144Help
Entry
b2144             CDS       T00007                                 

Gene name
sanA
Definition
(RefSeq) DUF218 superfamily vancomycin high temperature exclusion protein
  KO
K03748  SanA protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF218
Motif
Other DBs
NCBI-GeneID: 949003
NCBI-ProteinID: NP_416649
Pasteur: sanA
RegulonDB: ECK120001942
ECOCYC: EG12025
ASAP: ABE-0007091
UniProt: P0AFY2
Position
2232878..2233597
Genome map
AA seq 239 aa AA seqDB search
MLKRVFLSLLVLIGLLLLTVLGLDRWMSWKTAPYIYDELQDLPYRQVGVVLGTAKYYRTG
VINQYYRYRIQGAINAYNSGKVNYLLLSGDNALQSYNEPMTMRKDLIAAGVDPSDIVLDY
AGFRTLDSIVRTRKVFDTNDFIIITQRFHCERALFIALHMGIQAQCYAVPSPKDMLSVRI
REFAARFGALADLYIFKREPRFLGPLVPIPAMHQVPEDAQGYPAVTPEQLLELQKKQGK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagcgcgtgttcctcagcctgttagtcctgatcggcttgctgctgttgactgtg
ctcggcctcgatcgctggatgagctggaaaaccgcgccttatatctacgacgaattgcag
gatctcccctaccgccaggtcggtgtggtgctcggaacagcaaaatattatcgtactggc
gtaattaatcagtattatcgctaccgcattcaaggagcgattaatgcctataacagcggt
aaggtaaattatctattactgagcggcgataacgcattgcaaagttataatgagccgatg
accatgcgcaaagatttaatcgctgctggtgtcgacccatcagatattgttctcgattac
gcaggctttcgtacgctggattccatcgtgcgtacacgcaaagttttcgatactaatgat
ttcattattatcacccaacgtttccactgtgagcgagcattatttattgcgctgcatatg
gggattcaggctcagtgttatgccgtaccgtcaccgaaagatatgctgtcagtacgtatt
cgtgaatttgccgcccgtttcggtgcgctggctgacctttatatttttaaacgtgaaccg
cgttttttagggccgctggtccctattccggctatgcaccaggtaccggaagatgcgcag
gggtatcccgccgtcacacccgaacagttacttgaattacaaaagaaacaaggaaagtag

DBGET integrated database retrieval system