KEGG   Escherichia coli K-12 MG1655: b2147
Entry
b2147             CDS       T00007                                 

Gene name
preA
Definition
(RefSeq) NAD-dependent dihydropyrimidine dehydrogenase subunit PreA
  KO
K17723  dihydropyrimidine dehydrogenase (NAD+) subunit PreA [EC:1.3.1.1]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00240  Pyrimidine metabolism
eco00410  beta-Alanine metabolism
eco00770  Pantothenate and CoA biosynthesis
eco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    b2147 (preA)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    b2147 (preA)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    b2147 (preA)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.1  dihydropyrimidine dehydrogenase (NAD+)
     b2147 (preA)
SSDB
Motif
Pfam: DHO_dh Fer4_21 Dus Fer4 Fer4_6 Fer4_7 Fer4_10 Fer4_9 Fer4_2 Fer4_22 Fer4_4 Ligase_CoA MR_MLE_C NMO
Other DBs
NCBI-GeneID: 949037
NCBI-ProteinID: NP_416652
Pasteur: yeiA
RegulonDB: ECK120001262
ECOCYC: EG11289
ASAP: ABE-0007098
UniProt: P25889
Position
2235265..2236500
AA seq 411 aa
MLTKDLSITFCGVKFPNPFCLSSSPVGNCYEMCAKAYDTGWGGVVFKTIGFFIANEVSPR
FDHLVKEDTGFIGFKNMEQIAEHPLEENLAALRRLKEDYPDKVLIASIMGENEQQWEELA
RLVQEAGADMIECNFSCPQMTSHAMGSDVGQSPELVEKYCRAVKRGSTLPMLAKMTPNIG
DMCEVALAAKRGGADGIAAINTVKSITNIDLNQKIGMPIVNGKSSISGYSGKAVKPIALR
FIQQMRTHPELRDFPISGIGGIETWEDAAEFLLLGAATLQVTTGIMQYGYRIVEDMASGL
SHYLADQGFDSLQEMVGLANNNIVPAEDLDRSYIVYPRINLDKCVGCGRCYISCYDGGHQ
AMEWSEKTRTPHCNTEKCVGCLLCGHVCPVGCIELGEVKFKKGEKEHPVTL
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgttaacgaaagatctttcgattactttttgcggcgtgaagtttcccaacccgttctgc
ctctcttcttcgccggtaggcaactgctatgagatgtgtgccaaagcctacgacacaggt
tggggcggtgtggtgtttaaaacgatcggcttttttatcgccaacgaagtctcgccgcgt
tttgatcatctggtgaaagaagataccggttttatcggcttcaaaaatatggagcagatt
gctgaacatccgttggaagagaatctggccgccctgcgtcggctgaaggaagattacccg
gacaaagtattgatcgcttcgatcatgggggaaaatgagcagcaatgggaggagctggcg
cgcctggtgcaagaagctggcgcggatatgatcgagtgtaacttctcctgtccgcaaatg
acttctcatgcgatgggtagcgatgtcgggcaaagcccggagctggtagaaaaatattgt
cgggcagtgaaacggggttccacgctgccaatgctggcgaagatgacgccgaatatcggt
gatatgtgcgaagtggcgctggcggcgaagcgcggcggcgcagatggcattgcggcgatt
aacaccgttaaatccatcaccaatatcgatcttaatcagaaaatcggtatgccgatcgtt
aacggaaaatcgagtatttccggatattccggtaaagcggtaaaaccgatcgccctgcgc
ttcattcagcaaatgcgcacccatccagaactgcgcgatttcccaatcagcggtatcggc
ggcattgaaacctgggaggatgcggctgagtttttattgctcggcgcagcaacgttacag
gtgaccaccggcatcatgcagtacgggtatcggatagtggaagatatggcaagcgggttg
tcgcattatctcgccgatcagggatttgattcgctgcaggagatggtaggtctggcgaat
aacaatattgtcccggcggaagatttagaccgcagttatattgtctatccccgtatcaat
cttgataaatgtgttggctgtggacgctgttatatttcctgttacgacggcggtcaccag
gcgatggaatggagcgagaaaacccgcacaccgcattgtaataccgagaaatgtgtgggt
tgtctgctttgtggtcacgtctgcccggtgggttgtattgagctcggggaagtgaagttt
aagaaaggcgagaaagaacacccggtaacgttgtaa

DBGET integrated database retrieval system