KEGG   Escherichia coli K-12 MG1655: b2152Help
Entry
b2152             CDS       T00007                                 

Gene name
yeiB
Definition
(RefSeq) DUF418 domain-containing protein YeiB
  KO
K07148  uncharacterized protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    b2152 (yeiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF418
Motif
Other DBs
NCBI-GeneID: 949044
NCBI-ProteinID: NP_416657
Pasteur: yeiB
RegulonDB: ECK120001263
ECOCYC: EG11290
ASAP: ABE-0007115
UniProt: P25747 A0A387D2E0
Position
complement(2241810..2242967)
Genome map
AA seq 385 aa AA seqDB search
MERNVTLDFVRGVAILGILLLNISAFGLPKAAYLNPAWYGAITPRDAWTWAFLDLIGQVK
FLTLFALLFGAGLQMLLPRGRRWIQSRLTLLVLLGFIHGLLFWDGDILLAYGLVGLICWR
LVRDAPSVKSLFNTGVMLYLVGLGVLLLLGLISDSQTSRAWTPDASAILYEKYWKLHGGV
EAISNRADGVGNSLLALGAQYGWQLAGMMLIGAALMRSGWLKGQFSLRHYRRTGFVLVAI
GVTINLPAIALQWQLDWAYRWCAFLLQMPRELSAPFQAIGYASLFYGFWPQLSRFKLVLA
IACVGRMALTNYLLQTLICTTLFYHLGLFMHFDRLELLAFVIPVWLANILFSVIWLRYFR
QGPVEWLWRQLTLRAAGPAISKTSR
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcaacgtcacgctcgattttgttcgcggcgtcgccattctggggatcctgcta
ttaaacatcagcgcctttgggctaccaaaggcggcttatctcaatcccgcctggtacggt
gctattacgccgcgggatgcatggacttgggcatttcttgatctcatcggccaggtgaaa
ttcctcacgctttttgcgctactgtttggtgcgggcctgcaaatgttgctgccccgtggc
agacgctggatccagtcgcggttaacgctgttagtcttgttgggctttattcacggttta
ttgttctgggacggcgatattttgctggcttacgggctggtgggcttaatctgctggcgg
ctggtgcgcgatgcgccatcggtaaaaagcctgtttaatacaggcgtcatgctttatctg
gtggggcttggcgttttgctgttattggggctgatttccgacagccagaccagccgcgcc
tggacgccggatgcatcggctattttgtatgaaaaatactggaagcttcacggcggcgtt
gaagcgatcagtaatcgtgccgatggtgttggcaacagtttactggcactgggcgcacag
tatggctggcaactggcagggatgatgctcattggtgcggcgctgatgcgcagcggctgg
ctgaaagggcagttcagcttacgtcactatcgtcgtactggttttgtgctggtggcgatt
ggggtgaccattaaccttcctgccatcgccctgcaatggcagctggactgggcgtatcgc
tggtgtgccttcttacttcaaatgccgcgggaactgagtgcgccgtttcaggcgattggc
tatgcgtcgctgttttatggcttctggccgcaattgagccgctttaagctggtgcttgcg
atcgcctgcgtcggacggatggcgctgaccaactatctattgcaaacgctgatttgtacc
acgcttttttaccacctcggtttgtttatgcattttgaccgcctggagctgctggcgttt
gttattccggtatggctggcgaatatcctcttctctgttatctggctgcgttacttccgc
caggggccggtggaatggctctggcgtcagttaactttgcgtgctgccggaccggcaata
tctaaaacatcaagataa

DBGET integrated database retrieval system