KEGG   Escherichia coli K-12 MG1655: b2158
Entry
b2158             CDS       T00007                                 

Symbol
yeiH
Name
(RefSeq) conserved inner membrane protein YeiH
Organism
eco  Escherichia coli K-12 MG1655
SSDB
Motif
Pfam: Cons_hypoth698 DUF2231 LIDHydrolase
Other DBs
NCBI-GeneID: 946668
NCBI-ProteinID: NP_416663
Pasteur: yeiH
RegulonDB: ECK120001944
ECOCYC: EG12027
ASAP: ABE-0007142
UniProt: P62723
Position
2249717..2250766
AA seq 349 aa
MTNITLQKQHRTLWHFIPGLALSAVITGVALWGGSIPAVAGAGFSALTLAILLGMVLGNT
IYPHIWKSCDGGVLFAKQYLLRLGIILYGFRLTFSQIADVGISGIIIDVLTLSSTFLLAC
FLGQKVFGLDKHTSWLIGAGSSICGAAAVLATEPVVKAEASKVTVAVATVVIFGTVAIFL
YPAIYPLMSQWFSPETFGIYIGSTVHEVAQVVAAGHAISPDAENAAVISKMLRVMMLAPF
LILLAARVKQLSGANSGEKSKITIPWFAILFIVVAIFNSFHLLPQSVVNMLVTLDTFLLA
MAMAALGLTTHVSALKKAGAKPLLMALVLFAWLIVGGGAINYVIQSVIA
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgacgaatatcaccttacagaaacaacatcgtacactgtggcattttattccggggtta
gccctgagtgcagttatcaccggggtcgccctgtggggtggttccattcccgcggttgcg
ggtgccgggtttagtgccctcaccctcgcaatcttgttggggatggttttaggcaacacc
atctatccgcacatctggaaaagctgtgacggtggtgtgctgtttgccaagcaatattta
ttacgtctgggtatcattctttatggcttccgtctgacgttctcgcaaattgccgatgtc
ggtatcagtgggatcatcattgacgtgttgacgctgtccagtaccttcctgctggcttgc
ttcctggggcagaaagtgtttggtctggataagcacaccagctggttgatcggtgccggt
agcagtatctgtggtgctgccgcggtactggcgactgagccggtagtgaaagcggaagcc
agtaaagtaaccgtggctgttgcaaccgttgttatcttcgggaccgtcgcgattttcctc
tacccggcgatatatccgctgatgtctcaatggtttagtccggaaactttcggtatctac
attggttctactgtgcacgaagtggcgcaggtggtggcggcaggtcatgccatcagcccg
gatgcggaaaacgcagcagttatttccaaaatgctgcgcgtgatgatgctggctccgttc
ctcatcctgctggcggcgcgtgttaaacagctgtctggggcgaacagcggcgagaaaagc
aaaatcactattccgtggtttgccatcttgttcatcgtagttgccatctttaactcgttc
cacctgttaccgcagagcgtggtgaacatgctggtaacgctggataccttcctgctggca
atggcgatggcggcgctgggtctgaccactcacgtcagcgcgctgaaaaaagctggggcg
aaacctctgctgatggcactggtactgtttgcctggctgattgttggtggtggtgcgatt
aactatgtgattcaaagcgtcatcgcataa

DBGET integrated database retrieval system