KEGG   Escherichia coli K-12 MG1655: b2170
Entry
b2170             CDS       T00007                                 
Symbol
setB
Name
(RefSeq) sugar exporter SetB
  KO
K03291  MFS transporter, SET family, sugar efflux transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b2170 (setB)
Transporters [BR:eco02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar efflux transporter (SET) [TC:2.A.1.20]
    b2170 (setB)
SSDB
Motif
Pfam: MFS_1 MFS_1_like MFS_2
Other DBs
NCBI-GeneID: 946673
NCBI-ProteinID: NP_416675
Pasteur: yeiO
RegulonDB: ECK120001951
ECOCYC: EG12034
ASAP: ABE-0007184
UniProt: P33026
Position
2263863..2265044
AA seq 393 aa
MHNSPAVSSAKSFDLTSTAFLIVAFLTGIAGALQTPTLSIFLTDEVHARPAMVGFFFTGS
AVIGILVSQFLAGRSDKRGDRKSLIVFCCLLGVLACTLFAWNRNYFVLLFVGVFLSSFGS
TANPQMFALAREHADKTGREAVMFSSFLRAQVSLAWVIGPPLAYALAMGFSFTVMYLSAA
VAFIVCGVMVWLFLPSMRKELPLATGTIEAPRRNRRDTLLLFVICTLMWGSNSLYIINMP
LFIINELHLPEKLAGVMMGTAAGLEIPTMLIAGYFAKRLGKRFLMRVAAVGGVCFYAGML
MAHSPVILLGLQLLNAIFIGILGGIGMLYFQDLMPGQAGSATTLYTNTSRVGWIIAGSVA
GIVAEIWNYHAVFWFAMVMIIATLFCLLRIKDV
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcataactcccccgcagtctccagcgcgaaatcgtttgacctgacctcgacggcgttt
ttaatcgttgcctttctcaccggtattgcgggcgctctgcaaaccccgacactcagtatt
tttcttaccgatgaagtacatgcccgtccggcgatggtgggattcttctttaccggcagc
gctgtcattgggattctggtaagtcagtttctcgccgggcgctctgataagcgcggcgat
cgcaaatcgctgattgtcttttgctgcctgttaggcgtgctggcctgcaccctttttgcc
tggaatcgcaactactttgttttgctattcgttggcgtctttcttagcagctttggctcg
accgctaacccgcaaatgtttgcccttgcccgtgaacatgccgacaaaaccggacgtgag
gcggtgatgttcagctcttttttacgcgctcaggtttcactggcatgggtcattggccca
ccgctggcttatgccttagcgatgggtttcagctttacggtaatgtatctgagcgcagcg
gtagcgtttattgtttgcggtgtgatggtgtggctgtttttaccgtcgatgcgaaaagag
cttccgctggcgaccggcacgatcgaagcgccgcgccgtaaccgtcgcgatacgctgctg
ctgtttgtcatttgtacattgatgtggggctcgaacagcctgtacatcatcaacatgccg
ctatttattatcaacgaactgcatcttcccgagaaactggccggtgtgatgatggggacc
gccgccgggctggaaatcccgacgatgttgattgccggatatttcgccaaacgtctgggt
aagcgtttcttaatgcgcgttgctgccgtgggtggcgtctgtttttacgcaggaatgctg
atggcgcattcacctgtcattctgttgggcttgcagctgctaaatgctatttttattggc
attctgggcggcatcgggatgctctattttcaggatctgatgcccggtcaggcgggttca
gccaccacgctctataccaacacttcgcgcgtgggctggatcatcgcaggatcagtggcg
ggcatcgtcgccgagatctggaattatcacgctgtgttctggtttgcgatggtgatgatt
atcgccactctgttttgcttactgcggattaaagatgtttaa

DBGET integrated database retrieval system