KEGG   Escherichia coli K-12 MG1655: b2175
Entry
b2175             CDS       T00007                                 

Gene name
mepS
Definition
(RefSeq) peptidoglycan DD-endopeptidase/peptidoglycan LD-carboxypeptidase
  KO
K13694  murein DD-endopeptidase / murein LD-carboxypeptidase [EC:3.4.-.- 3.4.17.13]
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:eco01002]
    b2175 (mepS)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eco01011]
    b2175 (mepS)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.13  muramoyltetrapeptide carboxypeptidase
     b2175 (mepS)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     b2175 (mepS)
Peptidases and inhibitors [BR:eco01002]
 Cysteine peptidases
  Family C40
   b2175 (mepS)
Peptidoglycan biosynthesis and degradation proteins [BR:eco01011]
 Peptidoglycan biosynthesis and degradation
  Endopeptidase
   b2175 (mepS)
SSDB
Motif
Pfam: NLPC_P60 Peptidase_C92 LRAT DHQS CHAP DUF1287
Other DBs
NCBI-GeneID: 946686
NCBI-ProteinID: NP_416680
Pasteur: spr
RegulonDB: ECK120003725
ECOCYC: G7147
ASAP: ABE-0007200
UniProt: P0AFV4
Structure
PDB: 
2K1G

Position
2269979..2270545
AA seq 188 aa
MVKSQPILRYILRGIPAIAVAVLLSACSANNTAKNMHPETRAVGSETSSLQASQDEFENL
VRNVDVKSRIMDQYADWKGVRYRLGGSTKKGIDCSGFVQRTFREQFGLELPRSTYEQQEM
GKSVSRSNLRTGDLVLFRAGSTGRHVGIYIGNNQFVHASTSSGVIISSMNEPYWKKRYNE
ARRVLSRS
NT seq 567 nt   +upstreamnt  +downstreamnt
atggtcaaatctcaaccgattttgagatatatcttgcgcgggattcccgcgattgcagta
gcggttctgctttctgcatgtagtgcaaataacaccgcaaagaatatgcatcctgagaca
cgtgcagtgggtagtgaaacatcatcactgcaagcttctcaggatgaatttgaaaacctg
gttcgtaatgtcgacgtaaaatcgcgaattatggatcagtatgctgactggaaaggcgta
cgttatcgtctgggcggcagcactaaaaaaggtatcgattgttctggtttcgtacagcgt
acattccgtgagcaatttggcttagaacttccgcgttcgacttacgaacagcaggaaatg
ggtaaatctgtttcccgcagtaatttgcgtacgggtgatttagttctgttccgtgccggt
tcaacgggacgccatgtcggtatttatatcggcaacaatcagtttgtccatgcttccacc
agcagtggtgttattatttccagcatgaatgaaccgtactggaagaagcgttacaacgaa
gcacgccgggttctcagccgcagctaa

DBGET integrated database retrieval system