KEGG   Escherichia coli K-12 MG1655: b2179Help
Entry
b2179             CDS       T00007                                 

Gene name
yejE
Definition
(RefSeq) putative oligopeptide ABC transporter membrane subunit YejE
  KO
K13895  microcin C transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Module
eco_M00349  Microcin C transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b2179 (yejE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b2179 (yejE)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Microcin C transporter [MD:M00349]
    b2179 (yejE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 OppC_N
Motif
Other DBs
NCBI-GeneID: 946683
NCBI-ProteinID: NP_416684
Pasteur: yejE
RegulonDB: ECK120001956
ECOCYC: EG12040
ASAP: ABE-0007210
UniProt: P33915 A0A387CZP5
Position
2275273..2276298
Genome map
AA seq 341 aa AA seqDB search
MSRLSPVNQARWARFRHNRRGYWSLWIFLVLFGLSLCSELIANDKPLLVRYDGSWYFPLL
KNYSESDFGGPLASQADYQDPWLKQRLENNGWVLWAPIRFGATSINFATNKPFPSPPSRQ
NWLGTDANGGDVLARILYGTRISVLFGLMLTLCSSVMGVLAGALQGYYGGKVDLWGQRFI
EVWSGMPTLFLIILLSSVVQPNFWWLLAITVLFGWMSLVGVVRAEFLRTRNFDYIRAAQA
LGVSDRSIILRHMLPNAMVATLTFLPFILCSSITTLTSLDFLGFGLPLGSPSLGELLLQG
KNNLQAPWLGITAFLSVAILLSLLIFIGEAVRDAFDPNKAV
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgactcagccccgtcaatcaggcccgttgggcgcgttttcgtcataaccgtcgc
ggctactggtcgttatggattttcctcgtcttgtttggtttgagtttgtgttctgaactt
atcgccaacgataaaccgttgctggtgcgttatgacggcagttggtatttcccgttattg
aaaaactacagcgaaagcgattttggcggcccgctggcaagtcaggctgattatcaggac
ccgtggctgaaacaacggctggaaaataacggctgggtactgtgggcaccgattcgcttt
ggtgctaccagtatcaactttgctaccaataagcccttcccttctccaccctcccggcaa
aactggctgggaacggatgccaacggcggcgatgtgctggcacgcattctctatggcacg
cggatctcggttctgtttggcctgatgctgactctctgttccagcgtgatgggcgtgctg
gcgggggcgctacaaggctattacggcggtaaagtcgatctctggggacaacgctttatt
gaagtatggtcggggatgccgacgctgtttttgattattttactttccagcgtcgtacag
cctaacttctggtggctgctggcaattactgtcttgtttggctggatgagtctggtcggc
gtggtgcgggcggagtttttacgtactcgtaatttcgactacattcgtgcggcacaggcg
cttggcgtcagcgatcgcagtatcatcctgcgtcatatgttgcctaatgccatggtcgcg
accctcacctttttaccgtttattttatgtagttcgataaccaccctgacctcgctcgat
ttcctcggcttcggtctaccgctcggttcaccgtcactcggtgaactgctgttacaaggg
aaaaataaccttcaggccccgtggcttgggatcaccgccttcttgtcggtggcgatatta
ttgtctttgctgatctttattggtgaagccgtccgcgacgcatttgatcctaataaggcg
gtgtag

DBGET integrated database retrieval system