KEGG   Escherichia coli K-12 MG1655: b2182
Entry
b2182             CDS       T00007                                 
Symbol
bcr
Name
(RefSeq) multidrug efflux pump Bcr
  KO
K07552  MFS transporter, DHA1 family, multidrug resistance protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b2182 (bcr)
Transporters [BR:eco02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    b2182 (bcr)
SSDB
Motif
Pfam: MFS_1 Sugar_tr TRI12
Other DBs
NCBI-GeneID: 944808
NCBI-ProteinID: NP_416687
Pasteur: bcr
RegulonDB: ECK120001384
ECOCYC: EG11419
ASAP: ABE-0007221
UniProt: P28246
Position
complement(2278570..2279760)
AA seq 396 aa
MTTRQHSSFAIVFILGLLAMLMPLSIDMYLPALPVISAQFGVPAGSTQMTLSTYILGFAL
GQLIYGPMADSFGRKPVVLGGTLVFAAAAVACALANTIDQLIVMRFFHGLAAAAASVVIN
ALMRDIYPKEEFSRMMSFVMLVTTIAPLMAPIVGGWVLVWLSWHYIFWILALAAILASAM
IFFLIKETLPPERRQPFHIRTTIGNFAALFRHKRVLSYMLASGFSFAGMFSFLSAGPFVY
IEINHVAPENFGYYFALNIVFLFVMTIFNSRFVRRIGALNMFRSGLWIQFIMAAWMVISA
LLGLGFWSLVVGVAAFVGCVSMVSSNAMAVILDEFPHMAGTASSLAGTFRFGIGAIVGAL
LSLATFNSAWPMIWSIAFCATSSILFCLYASRPKKR
NT seq 1191 nt   +upstreamnt  +downstreamnt
gtgaccacccgacagcattcgtcgtttgctattgtttttatccttggcctgctggccatg
ttgatgccgctgtcgattgatatgtatctgcccgcgctaccggtaatttcagcgcagttt
ggcgtaccggcgggcagtacgcagatgaccctcagtacttatattctgggctttgcgttg
gggcagttaatctacgggccgatggcagacagcttcgggcgtaagccggtggtgctcggc
ggtacgctggtgtttgccgccgccgcggtggcgtgtgcgttggcaaacaccatcgatcag
ctgattgtgatgcgtttcttccacgggctggctgcggctgcggccagcgtggtcattaac
gccctgatgcgcgatatttacccgaaagaagagttctcgcggatgatgtcgtttgtcatg
ctggtgacaaccattgcaccgctgatggcaccgatagttggcggctgggtgctggtgtgg
ctgagctggcattacatcttctggatcctggcattagcggcgattctggcttcggcaatg
attttcttcctgattaaagaaaccttaccaccggagcgtcgtcagccatttcacattcgt
accactattggtaactttgcggcgctgttccgccataaacgtgtcctgagctacatgctt
gccagtggtttcagctttgccgggatgttctcattcttaagcgccggaccgtttgtttat
attgaaattaaccacgtcgcgccggaaaactttggttattactttgcgctaaacattgtt
tttctgttcgtgatgaccatctttaacagccgcttcgtccgccgcattggcgcgttaaat
atgttccgctcggggttgtggatacaatttattatggcagcgtggatggtcatcagtgcg
ctgctggggctgggattttggtcgctggtggttggcgttgcggcgtttgtgggctgcgtg
tcgatggtgtcatccaatgcgatggcggtcattcttgatgagtttccccatatggcggga
acggcatcttcgctggcaggaaccttccgttttggcataggggcaattgttggcgcattg
ctttctcttgcgacctttaactctgcatggccgatgatttggtcaattgcattctgcgca
accagctccattctcttctgtctgtacgccagtcggccgaaaaaacggtga

DBGET integrated database retrieval system