KEGG   Escherichia coli K-12 MG1655: b2240Help
Entry
b2240             CDS       T00007                                 

Gene name
glpT
Definition
(RefSeq) sn-glycerol 3-phosphate:phosphate antiporter
  KO
K02445  MFS transporter, OPA family, glycerol-3-phosphate transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b2240 (glpT)
Transporters [BR:eco02000]
 Major Facilitator Superfamily (MFS)
  Phosphate and organophosphate transporters
   Organophosphate:Pi antiporter (OPA) family [TC:2.A.1.4]
    b2240 (glpT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-GeneID: 946704
NCBI-ProteinID: NP_416743
Pasteur: glpT
RegulonDB: ECK120000394
ECOCYC: EG10401
ASAP: ABE-0007401
UniProt: P08194 A0A387CS23
Structure
PDB: 

Position
complement(2351016..2352374)
Genome map
AA seq 452 aa AA seqDB search
MLSIFKPAPHKARLPAAEIDPTYRRLRWQIFLGIFFGYAAYYLVRKNFALAMPYLVEQGF
SRGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAAAVMLFMGFVPWATSSI
AVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGM
AWFNDWHAALYMPAFCAILVALFAFAMMRDTPQSCGLPPIEEYKNDYPDDYNEKAEQELT
AKQIFMQYVLPNKLLWYIAIANVFVYLLRYGILDWSPTYLKEVKHFALDKSSWAYFLYEY
AGIPGTLLCGWMSDKVFRGNRGATGVFFMTLVTIATIVYWMNPAGNPTVDMICMIVIGFL
IYGPVMLIGLHALELAPKKAAGTAAGFTGLFGYLGGSVAASAIVGYTVDFFGWDGGFMVM
IGGSILAVILLIVVMIGEKRRHEQLLQERNGG
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgttgagtatttttaaaccagcgccacacaaagcgcgcttacctgccgcggagatcgat
ccgacttatcgtcgattgcgctggcaaattttcctggggatattctttggctatgcggct
tactatttggttcgtaagaactttgcgcttgctatgccttatctggttgagcagggattc
tcacgcggtgatttaggttttgccctttcggggatctcgattgcttatggattttcgaaa
ttcatcatgggttcggtatcggatcgctcgaatccgcgcgttttcctgcccgcaggtttg
attctggcggcggcagtgatgttgtttatgggctttgtgccatgggcgacgtcgagcatt
gcggtgatgtttgtactgttgttcctctgcggttggttccaggggatggggtggccgccg
tgtggtcgtactatggtgcactggtggtcgcagaaagaacgtggcggcattgtgtcagtg
tggaactgtgcgcacaacgtcggtggtggtattccgccgctgctgttcctgctggggatg
gcctggttcaatgactggcatgcggcgctctatatgcctgctttctgcgccattctggtg
gcattattcgcctttgcgatgatgcgcgataccccgcaatcctgtggcttgccgccgatc
gaagagtacaaaaatgattatccggacgactataacgaaaaagcggaacaggagctgacg
gcgaagcaaatcttcatgcagtacgtactgccgaacaaactgctgtggtatatcgccatc
gccaacgtgttcgtttatctgctgcgttacggcatcctcgactggtcaccgacttatctg
aaagaggttaagcatttcgcgctagataaatcctcctgggcctacttcctttatgaatat
gcaggtattccgggcactctgctgtgcggctggatgtcggataaagtcttccgtggcaac
cgtggggcaaccggcgttttctttatgacactggtgaccatcgcgactatcgtttactgg
atgaacccggcaggtaacccaaccgtcgatatgatttgtatgattgttatcggcttcctg
atctacggtcctgtgatgctgatcggtctgcatgcgctggaactggcaccgaaaaaagcg
gcaggtacggcagcgggctttaccgggctgtttggttacctgggcggttcggtggcggcg
agcgcgattgttggctacaccgtggacttcttcggctgggatggcggctttatggtaatg
attggcggcagcattctggcggttatcttgttgattgttgtgatgattggcgaaaaacgt
cgccatgaacaattactgcaagaacgcaacggaggctaa

DBGET integrated database retrieval system