KEGG   Escherichia coli K-12 MG1655: b2246
Entry
b2246             CDS       T00007                                 
Symbol
yfaV
Name
(RefSeq) putative transporter YfaV
Organism
eco  Escherichia coli K-12 MG1655
SSDB
Motif
Pfam: MFS_1 Imm21 Dpy19
Other DBs
NCBI-GeneID: 945796
NCBI-ProteinID: NP_416749
Pasteur: yfaV
RegulonDB: ECK120003735
ASAP: ABE-0007433
UniProt: P76470
Position
complement(2358863..2360152)
AA seq 429 aa
MSTALLDAVVKKNRVRLIPFMLALYVLAFLDRSNIGFAKQTYQIDTGLSNEAYALGAGIF
FVVYAFLGVPANLLMRKLGARTWIGTTTLLWGFLSAAMAWADTEAKFLIVRTLLRAAEAG
FFPGMIYLTSQWFPQRNRASIMGLFYMGAPLALTLGSPLSGALLEMHGFMGHPGWFWMFV
IEGLLAVGAGVFTFFWLDDTPEQARFLSKQEKTLLINQLASEEQQKVTSRLSDALRNGRV
WQLAIIYLTIQVAVYGLIFFLPTQVAALLGTKVGFTASVVTAIPWVAALFGTWLIPRYSD
KTGERRNVAALTLLAAGIGIGLSGLLSPVMAIVALCVAAIGFIAVQPVFWTMPTQLLSGT
ALAAGIGFVNLFGAVGGFIAPILRVKAETLFASDAAGLLTLAAVAVIGSLIIFTLRVNRT
VAQTDVAHH
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgagcaccgctttgcttgacgccgtggtgaagaaaaaccgtgtgcgtttaattccgttt
atgttggcgctgtatgtgctggcgtttctcgaccgttcgaatatcggttttgccaaacag
acctaccagattgataccgggttgagtaatgaagcttatgcgctgggagcaggcattttc
tttgtggtatatgcgtttctgggtgttccggcgaatcttttgatgcgcaaactgggggcc
agaacctggattggtacgacaacactgctgtggggatttctttcggcagccatggcatgg
gccgatactgaagcgaaatttctgatagttcgcactctgcttcgtgctgcggaggccgga
tttttccctggtatgatttatctcacctcgcaatggtttccgcagcgtaatcgcgccagc
attatggggctgttctatatgggcgcaccgctggcgttaacactgggatcaccgctttcc
ggcgcgctgttggagatgcatggatttatggggcatcccggctggttctggatgtttgtg
attgaaggattgttggcagtcggtgctggggtattcacattcttttggcttgatgacaca
ccggagcaggcacgttttctgagtaaacaagaaaaaacgttgcttatcaatcaactggca
agtgaagaacaacagaaagtgacttctcggctgagcgatgcgctgcgtaatggccgagtc
tggcaactagcgattatctacctgaccattcaggtggcggtttacggattaattttcttc
ctgccgacccaggttgcggcattgctgggaacaaaagtgggctttacagcgtcggtggtc
accgccattccgtgggttgcggccttgtttgggacctggcttattccgcgctattccgat
aaaaccggcgaacggcgtaatgtcgcagcgctgacattactggcggcgggcattggtatt
ggtctgtccgggctgctttctccagtaatggcgatcgtagcgctgtgtgttgcagctatc
gggtttattgccgtgcagccagtgttctggacgatgccgacacaactgctttccggtacg
gcgctggctgcgggaattggttttgtaaacctgtttggtgcagtgggcgggtttattgcc
ccgatcctgcgcgtgaaagcagaaacgttatttgccagcgatgcggcgggattactgacg
ctggcagcggtggcggtcatcggttcgctgattattttcactctgcgtgtaaatcgcact
gttgcgcagaccgacgtggcacatcattaa

DBGET integrated database retrieval system