KEGG   Escherichia coli K-12 MG1655: b2249
Entry
b2249             CDS       T00007                                 

Gene name
yfaY
Definition
(RefSeq) IPR008135 CinA family protein YfaY
Organism
eco  Escherichia coli K-12 MG1655
SSDB
Motif
Pfam: MoCF_biosynth CinA CinA_KH
Other DBs
NCBI-GeneID: 945478
NCBI-ProteinID: NP_416752
Pasteur: yfaY
RegulonDB: ECK120003738
ECOCYC: G7162
ASAP: ABE-0007441
UniProt: P77808
Position
complement(2362431..2363633)
AA seq 400 aa
MLKVEMLSTGDEVLHGQIVDTNAAWLADFFFHQGLPLSRRNTVGDNLDDLVTILRERSQH
ADVLIVNGGLGPTSDDLSALAAATAKGEGLVLHEAWLKEMERYFHERGRVMAPSNRKQAE
LPASAEFINNPVGTACGFAVQLNRCLMFFTPGVPSEFKVMVEHEILPRLRERFSLPQPPV
CLRLTTFGRSESDLAQSLDTLQLPPGVTMGYRSSMPIIELKLTGPASEQQAMEKLWLDVK
RVAGQSVIFEGTEGLPAQISRELQNRQFSLTLSEQFTGGLLALQLSRAGAPLLACEVVPS
QEETLAQTAHWITERRANHFAGLALAVSGFENEHLNFALATPDGTFALRVRFSTTRYSLA
IRQEVCAMMALNMLRRWLNGQDIASEHGWIEVVESMTLSV
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgttaaaagtggaaatgttatccaccggggatgaagtgttacacgggcaaatcgttgac
actaacgctgcctggctggccgattttttctttcatcaggggttgccattatctcgccgc
aatacggtgggggataaccttgatgacttagtcaccattcttcgcgaacgtagtcagcac
gccgatgtgctgatcgttaacggcgggctgggaccgaccagcgatgatttaagcgcactc
gccgctgcgacagcaaaaggtgaaggcctggtgctgcatgaagcctggctcaaagagatg
gaacgctatttccacgaacgtggacgagtaatggcaccgagcaaccgtaaacaagcggag
ctgcctgccagtgctgaatttatcaataacccggtaggcaccgcctgtggttttgccgtg
cagcttaatcgttgcctgatgttctttactcccggcgtaccgtcagaatttaaggtgatg
gtcgagcacgaaatcctgccgcgcctgcgcgagcgtttttctttaccgcagccgccggtt
tgtctgcgtttgactacttttggtcgttcggaaagcgatctggcacaaagcctggacact
ctacaactgccgccgggcgtaacaatgggctatcgctcctcaatgcctatcatcgaactg
aaactcaccggaccggcaagcgagcaacaggcgatggaaaaactgtggctggatgttaaa
cgtgttgccggacagagcgtgattttcgaaggcactgaaggactgcccgcgcagatcagt
cgcgaattgcaaaaccgccagttcagcctgacgttgagcgagcaattcaccggtggttta
ttggctttgcaactttctcgcgcaggtgctccattgctggcgtgtgaagtggttccttca
caggaggaaaccctggcgcaaactgcgcactggattacagaacggcgggccaaccatttt
gccgggctggcactggctgtttcgggtttcgagaacgagcatctcaactttgcgctagcc
acgccagacggcactttcgctctgcgtgtgcgtttcagcactacgcgctacagcctggct
atccgtcaggaagtgtgcgcaatgatggcactgaatatgctgcgccgttggttaaacggc
caggatatcgccagtgagcatggctggattgaggttgttgagtccatgaccttatctgtc
tga

DBGET integrated database retrieval system