KEGG   Escherichia coli K-12 MG1655: b2270
Entry
b2270             CDS       T00007                                 
Symbol
yfbK
Name
(RefSeq) IPR002035/DUF3520 domain-containing protein YfbK
  KO
K07114  Ca-activated chloride channel homolog
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b2270 (yfbK)
Transporters [BR:eco02000]
 Other transporters
  Pores ion channels [TC:1]
   b2270 (yfbK)
SSDB
Motif
Pfam: DUF3520 vWF_A VWA VWA_2 VWA_3 Sec23_trunk
Other DBs
NCBI-GeneID: 946743
NCBI-ProteinID: NP_416773
Pasteur: yfbK
RegulonDB: ECK120003753
ECOCYC: G7177
ASAP: ABE-0007501
UniProt: P76481
Position
complement(2383995..2385722)
AA seq 575 aa
MRNKNIIMLLMSSLILSGCGPQPENKESQQQQPSTPTEQQVLAAQQAAIKEAEQSAAAAK
ALAQQEVQQYSDKQALQGRLQEAPTFARAAKAKATHIANPGTARYQQFDDNPVKQVAQNP
LATFSLDVDTGSYANVRRFLNQGLLPPPDAVRVEEIVNYFPSDWDIKDKQSIPASKPIPF
AMRYELAPAPWNEQRTLLKVDILAKDRKSEELPASNLVFLIDTSGSMISDERLPLIQSSL
KLLVKELREQDNIAIVTYAGDSRIALPSISGSHKAEINAAIDSLDAEGSTNGGAGLELAY
QQATKGFIKGGINRILLATDGDFNVGIDDPKSIESMVKKQRESGVTLSTFGVGNSNYNEA
MMVRIADVGNGNYSYIDTLSEAQKVLNSEMRQMLITVAKDVKAQIEFNPAWVTEYRQIGY
EKRQLRVEHFNNDNVDAGDIGAGKHITLLFELTLNGQKASIDKLRYAPDNKLAKSDKTKE
LAWLKIRWKYPQGKESQLVEFPLGPTINAPSEDMRFRAAVAAYGQKLRGSEYLNNTSWQQ
IKQWAQQAKGEDPQGYRAEFIRLIELADGVTDISQ
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgcgaaataaaaatataatcatgttgcttatgagtagtttgattttgtcaggatgtggg
ccgcaacctgagaataaggaaagtcagcaacaacaacccagtactcccacagagcagcaa
gtgcttgccgcgcagcaagctgcaataaaagaggctgagcaaagcgccgccgccgcgaaa
gccttggcccagcaagaagtgcaacaatattcagacaaacaggctttacaggggcgattg
caggaagcgccaacatttgcaagagcggctaaagcaaaagctacacatatcgcaaatcca
ggaaccgctcgctaccagcagttcgatgataatccggttaagcaggtagcgcaaaatccg
ttggcgacgtttagtcttgacgttgacactggcagttatgcgaatgtaaggcgtttcctc
aatcaagggctgttacctccgccagacgctgtgcgggtggaggagatagtcaattatttc
ccgtctgattgggatatcaaagacaaacaatctattccggcctctaagccaatacctttc
gctatgcgctacgaattggcacctgcaccatggaatgaacagcgaacattgctgaaagtt
gatatcctggcgaaagatcgcaaaagtgaagagttaccagcttctaatctggtctttctt
atcgacacttctggttcaatgatttctgatgaacgtttgccacttatccagtcttcgttg
aaattattggtcaaagaacttcgtgagcaggataacattgccatcgtgacctacgctggc
gactcccgtattgcattgccttctatctccgggagtcataaggcggaaattaatgccgca
attgattcgctggatgccgaaggcagtaccaatggcggtgccgggctggaactggcttat
cagcaggcgacgaaggggtttattaagggcggcatcaatcgcattttattagccactgac
ggtgactttaacgttggcattgacgatccaaaatcgattgaatcaatggtcaaaaaacag
cgggagtctggtgttactctgtcgacgtttggcgtggggaatagcaattacaacgaggca
atgatggtgcgaattgccgatgttggtaacggcaactacagctacattgataccctctct
gaagcgcagaaagtattgaatagtgaaatgcggcagatgttgattaccgtagcaaaagat
gtcaaagcgcaaattgagtttaaccccgcgtgggtaacggaataccgtcagattggttat
gaaaagcgccaacttcgggtggaacattttaataacgacaacgttgatgcaggggatata
ggcgcaggcaaacatataacgttgttattcgaattaacgctgaacgggcaaaaagcatca
attgataagttacgctatgccccggataacaaattagcgaaatcggacaaaacgaaagaa
ctggcctggttaaaaattcgctggaaatacccgcagggaaaagaaagtcagttagttgaa
ttcccgctggggccaacaataaacgcgccctctgaagatatgcgttttcgcgcagcagta
gctgcatatgggcaaaagttacgcggttctgaatacctgaacaatacctcctggcagcag
atcaaacagtgggctcagcaggcaaaaggggaagatccacagggttacagggcggaattt
attcgcctgattgaactggcggatggtgtgactgacatcagtcagtga

DBGET integrated database retrieval system