KEGG   Escherichia coli K-12 MG1655: b2272Help
Entry
b2272             CDS       T00007                                 

Gene name
yfbM
Definition
(RefSeq) DUF1877 domain-containing protein YfbM
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1877
Motif
Other DBs
NCBI-GeneID: 946745
NCBI-ProteinID: NP_416775
Pasteur: yfbM
RegulonDB: ECK120003755
ECOCYC: G7179
ASAP: ABE-0007509
UniProt: P76483
Structure
PDB: 

Position
2386934..2387437
Genome map
AA seq 167 aa AA seqDB search
MGMIGYFAEIDSEKINQLLESTEKPLMDNIHDTLSGLRRLDIDKRWDFLHFGLTGTSAFD
PAKNDPLSRAVLGEHSLEDGIDGFLGLTWNQELAATIDRLESLDRNELRKQFSIKRLNEM
EIYPGVTFSEELEGQLFASIMLDMEKLISAYRRMLRQGNHALTVIVG
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgggaatgattggctattttgcagaaattgactcagaaaagattaaccaactgcttgag
tctactgaaaaacctttgatggataatatacatgacacgctttcaggattacgccgactg
gatattgataaacgctgggattttttacactttgggctgacaggcacctctgcttttgat
cccgcgaagaatgatccgctgagtcgtgccgtgcttggtgaacacagcctcgaagatggc
atagatggcttccttggattgacctggaatcaggagttagccgcgacaatcgaccgactg
gaatcactggatcgaaatgaactgcgtaaacagttttccattaagcgactcaatgaaatg
gagatttatccgggagtgaccttttcagaagagttagaggggcaactctttgcctcgatc
atgcttgatatggaaaagctgattagcgcgtatcgacgtatgctgcgacaagggaatcat
gcgctgacggttattgttgggtga

DBGET integrated database retrieval system