KEGG   Escherichia coli K-12 MG1655: b2286Help
Entry
b2286             CDS       T00007                                 

Gene name
nuoC
Definition
(RefSeq) NADH:ubiquinone oxidoreductase, fused CD subunit
  KO
K13378  NADH-quinone oxidoreductase subunit C/D [EC:1.6.5.3]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00190  Oxidative phosphorylation
eco01100  Metabolic pathways
Module
eco_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    b2286 (nuoC)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     b2286 (nuoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Complex1_49kDa Complex1_30kDa
Motif
Other DBs
NCBI-GeneID: 946759
NCBI-ProteinID: NP_416789
RegulonDB: ECK120001990
ECOCYC: EG12084
ASAP: ABE-0007549
UniProt: P33599
Position
complement(2402055..2403845)
Genome map
AA seq 596 aa AA seqDB search
MTDLTAQEPAWQTRDHLDDPVIGELRNRFGPDAFTVQATRTGVPVVWIKREQLLEVGDFL
KKLPKPYVMLFDLHGMDERLRTHREGLPAADFSVFYHLISIDRNRDIMLKVALAENDLHV
PTFTKLFPNANWYERETWDLFGITFDGHPNLRRIMMPQTWKGHPLRKDYPARATEFSPFE
LTKAKQDLEMEALTFKPEEWGMKRGTENEDFMFLNLGPNHPSAHGAFRIVLQLDGEEIVD
CVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNEMPYVLAVEKLAGITVPDRVN
VIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQKIYDLVEAITGFRMHPAWFR
IGGVAHDLPRGWDRLLREFLDWMPKRLASYEKAALQNTILKGRSQGVAAYGAKEALEWGT
TGAGLRATGIDFDVRKARPYSGYENFDFEIPVGGGVSDCYTRVMLKVEELRQSLRILEQC
LNNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVSWGPVMPANESFQMIEATKGIN
SYYLTSDGSTMSYRTRVRTPSFAHLQQIPAAIRGSLVSDLIVYLGSIDFVMSDVDR
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacttaaccgcgcaagaacccgcctggcagacccgcgatcatcttgatgatccg
gtgattggcgaactgcgcaaccgttttgggccggatgcctttactgttcaggcgactcgc
accggggttcccgttgtgtggatcaagcgtgaacaattactggaagttggcgatttctta
aagaaactgccgaaaccttacgtcatgctgtttgacttacacggcatggacgaacgtctg
cgcacacaccgcgaagggttacctgccgcggatttttccgttttctaccatctgatttct
atcgatcgtaaccgcgacatcatgctgaaggtggcgctggcagaaaacgacctgcacgta
ccgaccttcaccaaactgttcccgaacgctaactggtatgagcgtgaaacctgggatctg
tttggcattactttcgacggtcacccgaacctgcgacgcatcatgatgccgcaaacctgg
aaaggtcacccgctgcgtaaagattatccggcgcgcgctaccgaattctcgccgtttgag
ctgaccaaagccaaacaggatctggagatggaagccctgaccttcaaaccggaagagtgg
gggatgaagcgcggcaccgaaaacgaggacttcatgttcctcaacctcggtccgaaccac
ccgtcggcgcacggggctttccgtatcgttttgcaactcgatggcgaagagattgtcgac
tgcgtaccagacatcggttaccaccaccgtggtgcggagaaaatgggcgaacgccagtcc
tggcacagctacattccgtatactgaccgtatcgaatacctcggcggctgcgttaacgaa
atgccttacgtgctggcggtagagaaactggccgggatcaccgtgccggatcgcgttaac
gtcattcgcgttatgctctccgaactgttccgcatcaacagtcacctgctgtatatctcg
acctttattcaggacgtcggcgcaatgacgccagtgttcttcgcctttaccgatcgtcag
aaaatttacgatctggtggaagcaatcactggtttccgtatgcacccggcgtggttccgt
attggcggcgtagcgcacgacctgccgcgcggctgggatcgcctgctgcgtgagttcctc
gactggatgccgaaacgtctggcgtcttacgagaaagcggcgctgcaaaacaccattctg
aaaggtcgttcccagggcgttgccgcctatggcgcgaaagaggcgctggagtggggcacc
actggcgcgggcctgcgtgctaccgggatcgacttcgacgtgcgtaaggcgcgtccttat
tctggctatgaaaacttcgactttgaaatcccggtgggtggtggcgtttctgactgctac
acccgcgtaatgcttaaagtggaagagctgcgccagagtctgcgcattcttgagcagtgc
ctcaacaacatgccggaaggcccgttcaaagcggatcacccgctgaccacgccgccgccg
aaagagcgcacgctgcaacatatcgaaaccctgatcacccacttcctgcaagtgtcgtgg
ggtccggtgatgcctgccaatgaatctttccagatgattgaggcgaccaaagggatcaac
agttactacctgaccagcgacggcagcaccatgagttaccgcacccgtgttcgtaccccg
agctttgcgcatttgcagcaaattccggcggcgatccgcggcagcctggtgtctgacctg
attgtttatctgggcagtatcgattttgttatgtcagatgtggaccgctaa

DBGET integrated database retrieval system