KEGG   Escherichia coli K-12 MG1655: b2306Help
Entry
b2306             CDS       T00007                                 

Gene name
hisP
Definition
(RefSeq) lysine/arginine/ornithine ABC transporter/histidine ABC transporter, ATP binding subunit
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b2306 (hisP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b2306 (hisP)
Enzymes [BR:eco01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     b2306 (hisP)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    b2306 (hisP)
   Histidine transporter
    b2306 (hisP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_29 AAA_13 ABC_ATPase AAA_16 AAA_23 PRK G-alpha AAA_33 RsgA_GTPase AAA_24 FtsK_SpoIIIE DUF87 NACHT AAA_22
Motif
Other DBs
NCBI-GeneID: 946789
NCBI-ProteinID: NP_416809
Pasteur: hisP
RegulonDB: ECK120000445
ECOCYC: EG10452
ASAP: ABE-0007610
UniProt: P07109
Position
complement(2423736..2424509)
Genome map
AA seq 257 aa AA seqDB search
MSENKLNVIDLHKRYGEHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSEG
SIVVNGQTINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQV
LGLSKQEARERAVKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPEVLLFDEPT
SALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSTHVIFLHQGKIEEEGAPEQLF
GNPQSPRLQRFLKGSLK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagaataaattaaacgttatcgatttgcacaaacgctacggcgaacatgaagtg
ctgaaaggggtatcactgcaagcgaatgccggagatgtaataagcatcatcggatcgtcg
ggatcggggaaaagtacctttctgcgctgcattaacttcctcgaaaaaccgagtgaaggg
tcgatcgtggtcaatggccagacgatcaatctggtgcgcgacaaagacggtcaactcaaa
gtcgccgataaaaatcaactgcgcttactgcgcacacgcctgacgatggtattccagcac
ttcaatctctggagccatatgacggtgctggaaaacgtcatggaagcgccgattcaggtg
ttgggcctgagcaagcaggaagcgcgcgagcgggcggtgaagtatctggcaaaagtcggg
atagacgaacgtgcgcaggggaaatatccggtgcatctttccggcggtcagcaacagcgt
gtttctatcgcgcgggcgctggcgatggaaccggaagttttactgtttgatgaacctacc
tcggcgctcgatcctgaactggtaggcgaagtgttgcgtattatgcagcaactggcagaa
gaggggaaaaccatggtggtagtgactcacgaaatgggctttgctcgccatgtttctact
catgtcattttcctccatcaggggaaaatagaagaagagggcgcgccggagcagttattt
ggcaacccgcaaagccctcgtctgcaacggttccttaagggatcgctgaaataa

DBGET integrated database retrieval system